Recombinant Human RALB Protein
Beta LifeScience
SKU/CAT #: BLA-7621P
Recombinant Human RALB Protein
Beta LifeScience
SKU/CAT #: BLA-7621P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P11234 |
Synonym | 5730472O18Rik dRalb GTP binding protein Ralb RALB_HUMAN RAS like protein B RAS like proto oncogene B Ras related GTP binding protein B Ras-related protein Ral-B V ral simian leukemia viral oncogene homolog B v ral simian leukemia viral oncogene homolog B (ras related GTP binding protein) v ral simian leukemia viral oncogene homolog B (ras related) |
Description | Recombinant Human RALB Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMAANKSKGQSSLALHKVIMVGSGGVG KSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYA AIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVV GNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREI RTKKMSENKDKNGKKSSKNKKSFKERC |
Molecular Weight | 26 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |