Recombinant Human RAET1E Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-7602P
Recombinant Human RAET1E Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-7602P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q8TD07 |
Synonym | bA350J20.7 LETAL Lymphocyte effector toxicity activation ligand MGC125308 MGC125309 N2DL-4 N2DL4 N2DL4_HUMAN NKG2D ligand 4 NKG2D ligand 4 precursor NKG2DL4 RAE-1-like transcript 4 RAET1E RAET1E2 Retinoic acid early transcript 1E RL-4 |
Description | Recombinant Human RAET1E Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Protein fragment |
Source | Baculovirus infected insect cells |
AA Sequence | ADPHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLL GKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQ REAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGL EKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDHH HHHH |
Molecular Weight | 23 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |