Recombinant Human RAB5C/RABL Protein

Name: Recombinant Human RAB5C/RABL Protein
Brand: Beta LifeScience
SKU: BLA-7560P
Availability: InStock

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P51148
Synonym	L1880 RAB, member of RAS oncogene family like RAB5C RAB5C, member of RAS oncogene family RAB5C, member RAS oncogene family RAB5C_HUMAN RAB5CL RAB5L RABL Ras-related protein Rab-5C
Description	Recombinant Human RAB5C/RABL Protein was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	MGSSHHHHHHSSGLVPRGSHMGSMAGRGGAARPNGPAAGNKICQFKLVLL GESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDT AGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNI VIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMA IAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
Molecular Weight	26 kDa including tags
Purity	Greater than 90% SDS-PAGE
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Protein transport. Probably involved in vesicular traffic.
Subcellular Location	Cell membrane; Lipid-anchor; Cytoplasmic side. Early endosome membrane; Lipid-anchor. Melanosome.
Protein Families	Small GTPase superfamily, Rab family
Database References	HGNC: 9785 OMIM: 604037 KEGG: hsa:5878 STRING: 9606.ENSP00000345689 UniGene: Hs.650382

Gene Functions References

We identify RAB5C as a new candidate gene for type-2 diabetes risk with a functional role in endosomal type-2 diabetes module. Functional analysis shows that RAB5C is tyrosine phosphorylated. Data analysis reveals a tyrosine phosphorylation motif in the GTP binding site of RAB5C which may be targeted by insulin receptor. Insulin-dependent tyrosine phosphorylation of RAB5C is inhibited by overexpression of HACD3 (PTPLAD1). PMID: 30300385
Enforced miR-509 expression in NALM6 cells reduced RAB5C mRNA and protein levels, and RAB5C was demonstrated to be a direct target of miR-509. PMID: 25368993
PLP2 and RAB5C are binding partners of TPD52. PMID: 24604726
Rab5C modulates Rac1-mediated cell motility. PMID: 24587345
GTP-Rab5c also bound to AMAP1, and activation of Rab5c by EGFR signaling was necessary to promote the intracellular association of AMAP1 and PRKD2 PMID: 22734003

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.