Recombinant Human RAB5C/RABL Protein
Beta LifeScience
SKU/CAT #: BLA-7560P
Recombinant Human RAB5C/RABL Protein
Beta LifeScience
SKU/CAT #: BLA-7560P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P51148 |
Synonym | L1880 RAB, member of RAS oncogene family like RAB5C RAB5C, member of RAS oncogene family RAB5C, member RAS oncogene family RAB5C_HUMAN RAB5CL RAB5L RABL Ras-related protein Rab-5C |
Description | Recombinant Human RAB5C/RABL Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMAGRGGAARPNGPAAGNKICQFKLVLL GESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDT AGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNI VIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMA IAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN |
Molecular Weight | 26 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |