Recombinant Human RAB38 Protein
Beta LifeScience
SKU/CAT #: BLA-7549P
Recombinant Human RAB38 Protein
Beta LifeScience
SKU/CAT #: BLA-7549P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P57729 |
Synonym | Antigen NY MEL 1 Melanoma antigen NY MEL 1 Melanoma antigen NY-MEL-1 NY MEL 1 RAB 38 Rab related GTP binding protein Rab38 RAB38 member RAS oncogene family RAB38_HUMAN Ras related protein Rab 38 Ras-related protein Rab-38 rrGTPbp |
Description | Recombinant Human RAB38 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MASMTGGQQMGRGHHHHHHENLYFQGGEFQAPHKEHLYKLLVIGDLGVGK TSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQERF GNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPVSV VLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRC LVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAKS |
Molecular Weight | 27 kDa including tags |
Purity | >90% SDS-PAGE.Expressed in E. coli as inclusion bodies, refolded using temperature shift inclusion body refolding technology, chromatographically purified and sterile-filtered. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C. |