Recombinant Human RAB35 Protein
Beta LifeScience
SKU/CAT #: BLA-7546P
Recombinant Human RAB35 Protein
Beta LifeScience
SKU/CAT #: BLA-7546P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q15286 |
Synonym | GTP binding protein RAY GTP-binding protein RAY H ray OTTHUMP00000240256 OTTHUMP00000240257 OTTHUMP00000240258 OTTHUMP00000240259 RAB1C Rab35 RAB35 member RAS oncogene family RAB35, member RAS oncogene family RAB35_HUMAN Ras related protein Rab 1C Ras related protein rab 1c (GTP binding protein ray) Ras related protein Rab35 Ras-related protein Rab-1C Ras-related protein Rab-35 RAY |
Description | Recombinant Human RAB35 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMARDYDHLFKLLIIGDSGVGKSSLLLRFAD NTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRG THGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVV ETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQ QQQQNDVVKLTKNSKRKKRCC |
Molecular Weight | 25 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |