Recombinant Human RAB32 Protein
Beta LifeScience
SKU/CAT #: BLA-7541P
Recombinant Human RAB32 Protein
Beta LifeScience
SKU/CAT #: BLA-7541P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q13637 |
Synonym | RAB32 RAB32, member RAS oncogene family RAB32_HUMAN Ras related protein Rab32 Ras-related protein Rab-32 |
Description | Recombinant Human RAB32 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMAGGGAGDPGLGAAAAPAPETREHLF KVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTL VRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKS DLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFE TSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAEN KSQCC |
Molecular Weight | 28 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |