Recombinant Human Rab24 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-7534P
Recombinant Human Rab24 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-7534P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q969Q5 |
Synonym | OTTHUMP00000161435 OTTHUMP00000161437 OTTHUMP00000223588 Rab 24 RAB24 RAB24, member RAS oncogene family RAB24_HUMAN Ras related protein Rab 24 Ras-related protein Rab-24 |
Description | Recombinant Human Rab24 Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MASMTGGQQMGRGHHHHHHENLYFQGGEFSGQRVDVKVVMLGKEYVGKTS LVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERYEA MSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKS DLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDY VSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH |
Molecular Weight | 26 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle. |