Recombinant Human PTPMT1 Protein
Beta LifeScience
SKU/CAT #: BLA-7470P
Recombinant Human PTPMT1 Protein
Beta LifeScience
SKU/CAT #: BLA-7470P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q8WUK0 |
Synonym | DUSP23 FLJ46081 MOSP NB4 apoptosis/differentiation related protein Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 Phosphoinositide lipid phosphatase PLIP PNAS 129 protein tyrosine phosphatase mitochondrial 1 Protein-tyrosine phosphatase mitochondrial 1 pten like phosphatase PTEN-like phosphatase PTPM1_HUMAN Ptpmt1 |
Description | Recombinant Human PTPMT1 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMKVPGRAHRDWYHRIDPTVLLGALPL RSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDM TGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHK WSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT |
Molecular Weight | 23 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Lipid phosphatase which dephosphorylates phosphatidylglycerophosphate (PGP) to phosphatidylglycerol (PG). PGP is an essential intermediate in the biosynthetic pathway of cardiolipin, a mitochondrial-specific phospholipid regulating the membrane integrity and activities of the organelle. Has also been shown to display phosphatase activity toward phosphoprotein substrates, specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells. May prevent intrinsic apoptosis, probably by regulating mitochondrial membrane integrity. |
Subcellular Location | Mitochondrion inner membrane; Peripheral membrane protein; Matrix side. |
Protein Families | Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily |
Database References |
Gene Functions References
- A key role for HIF-2alpha-induced Ptpmt1 up-regulation in proliferation, survival and glucose metabolism of erythroleukemia cells. PMID: 26898802
- our data support a model in which MK-STYX controls apoptosis by negatively regulating PTPMT1. PMID: 24709986
- Our data suggest that inhibition of PTPMT1 causes a metabolic crisis in cancer cells that induces cell death, and may be a mechanism by which cancer cells can be sensitized to currently available therapies. PMID: 23326511