Recombinant Human PTPMT1 Protein
Beta LifeScience
SKU/CAT #: BLA-7470P
Recombinant Human PTPMT1 Protein
Beta LifeScience
SKU/CAT #: BLA-7470P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q8WUK0 |
Synonym | DUSP23 FLJ46081 MOSP NB4 apoptosis/differentiation related protein Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 Phosphoinositide lipid phosphatase PLIP PNAS 129 protein tyrosine phosphatase mitochondrial 1 Protein-tyrosine phosphatase mitochondrial 1 pten like phosphatase PTEN-like phosphatase PTPM1_HUMAN Ptpmt1 |
Description | Recombinant Human PTPMT1 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMKVPGRAHRDWYHRIDPTVLLGALPL RSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDM TGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHK WSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT |
Molecular Weight | 23 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |