Recombinant Human PSMD9 Protein
Beta LifeScience
SKU/CAT #: BLA-7431P
Recombinant Human PSMD9 Protein
Beta LifeScience
SKU/CAT #: BLA-7431P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O00233 |
Synonym | 26S proteasome non ATPase regulatory subunit 9 26S proteasome non-ATPase regulatory subunit 9 26S proteasome regulatory subunit p27 Homolog of rat Bridge 1 MGC8644 p27 Proteasome (prosome macropain) 26S subunit non ATPase 9 Proteasome 26S non ATPase regulatory subunit 9 Proteasome 26S subunit non ATPase 9 PSMD 9 Psmd9 PSMD9_HUMAN Rpn4 |
Description | Recombinant Human PSMD9 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMSDEEARQSGGSSQAGVVTVSDVQELM RRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTARH NIICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAMSRKLGQS ESQGPPRAFAKVNSISPGSPASIAGLQVDDEIVEFGSVNTQNFQSLHNIG SVVQHSEGKPLNVTVIRRGEKHQLRLVPTRWAGKGLLGCNIIPLQR |
Molecular Weight | 27 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |