Recombinant Human PRRT2 Protein
Beta LifeScience
SKU/CAT #: BLA-7386P
Recombinant Human PRRT2 Protein
Beta LifeScience
SKU/CAT #: BLA-7386P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q7Z6L0-3 |
Synonym | interferon induced transmembrane protein domain containing 1 BFIC2 BFIS2 Dispanin subfamily B member 3 DSPB3 Dystonia 10 DYT10 EKD1 FICCA FLJ25513 ICCA IFITMD1 Infantile convulsions and paroxysmal choreoathetosis PKC Proline rich transmembrane protein 2 Proline-rich transmembrane protein 2 PRRT2 PRRT2_HUMAN |
Description | Recombinant Human PRRT2 Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMAASSSEISEMKGVEESPKVPGEGPGH SEAETGPPQVLAGVPDQPEAPQPGPNTTAAPVDSGPKAGLAPETTETPAG ASETAQATDLSLSPGGESKANCSPEDPCQETVSKPEVSKEATADQGSRLE SAAPPEPAPEPAPQPDPRPDSQPTPKPALQPELPTQEDPTPEILSESVGE KQENGAVVPLQAGDGEEGPAPEPHSPPSKKSPPANGAPPRVLQQLVEEDR MRRAHSGHPGSPRGSLSRHPSSQLAGPGVEGGEGTQKPRDY |
Molecular Weight | 30 kDa including tags |
Purity | Greater than 85% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |