Recombinant Human Protein Delta Homolog 1 (DLK1) Protein (His)

Name: Recombinant Human Protein Delta Homolog 1 (DLK1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03650P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Protein Delta Homolog 1 (DLK1) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P80370
Target Symbol	DLK1
Synonyms	Adipocyte differentiation inhibitor protein; Brevideltin; Delta like 1 homolog; Delta like homolog; Delta like protein; Delta1; DLK 1; DLK; DLK-1; DLK1; DLK1_HUMAN; FA 1; FA1; Fetal antigen 1; pG2; Preadipocyte factor 1; Pref 1; Pref; Pref1; Protein delta homolog 1; Secredeltin; ZOG
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
Expression Range	24-303aa
Protein Length	Partial
Mol. Weight	33.8kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May have a role in neuroendocrine differentiation.
Subcellular Location	Membrane; Single-pass type I membrane protein. Cytoplasm.
Database References	HGNC: 2907 OMIM: 176290 KEGG: hsa:8788 STRING: 9606.ENSP00000340292 UniGene: PMID: 30084829 We conclude methylation changes at some CpG sites of MEST and DLK differentially methylated regions in preeclamptic group PMID: 29157033 point mutations in DLK1 and KCNK9 at least do not seem to be a common cause of central precocious puberty in girls. PMID: 28672280 The expression of piRNAs encoded at DLK1-DIO3 enhances the prognostic potential of small non-coding RNAs specific to this locus in predicting lung cancer patient outcome. PMID: 27829231 targeting DLK1 might inhibit the tumor growth via initiating cell differentiation of hepatocellular carcinoma (HCC) cancer stem cell. PMID: 27683116 SASH1 acts through NOTCH1 and its inhibitor DLK1 in a three-dimensional model of lumenogenesis involving CEACAM1. PMID: 28823832 The data presented in this work suggest that a fine regulation of NOTCH signaling BY DLK1 plays an important role in the control of breast cancer cell proliferation and invasion. PMID: 28461338 results demonstrate that miR-129-5p inhibits non-small cell lung cancer stemness and chemoresistance through direct targeting of DLK1 PMID: 28619508 A complex defect of DLK1 ( approximately 14-kb deletion and 269-bp duplication) was identified in a family with central precocious puberty. This deletion included the 5' untranslated region and the first exon of DLK1, including the translational start site. Only family members who inherited the defect from their father have precocious puberty, consistent with the known imprinting of DLK1. PMID: 28324015 Loss of DLK1 expression is associated with fetal growth retardation complications of pregnancy. PMID: 27776119 In neonatal skin, DLK1 exhibited a high degree of monoallelic expression from the paternal allele. PMID: 27329732 The study evaluated the roles of extracellular soluble DLK1, comprising six EGF-like domains and juxtamembrane regions, in human pancreatic cancer MIA PaCa-2 cells in vitro and in vivo. Soluble DLK1 exerted antitumor effects not only in cancer cell migration and anchorage-independent cell growth but also in in vivo tumor growth. PMID: 27191393 Treatment of mice with recombinant human DLK1 during pregnancy has significant effects on AT of the offspring. This can be associated with counter-regulatory changes in the Notch1 signaling cascade. PMID: 26499442 NOTCH1 ligand Delta-like 1 homolog (DLK1) self interacts PMID: 28099888 Pref-1 induces insulin synthesis and secretion via two independent pathways PMID: 27044861 Data from longitudinal, nested case-control study conducted in rural South Korea suggest that low serum levels of DLK1 (preadipocyte factor 1) may be useful biomarker for identifying women (but not men) at high risk of developing insulin resistance, prediabetes, and type 2 diabetes. PMID: 26220259 The appropriate timing of Dll1 expression is critical for its oscillatory expression, pointing to the functional significance of Dll1-mediated oscillatory cell-cell interactions in the segmentation clock. [review] PMID: 26818178 Results suggest a potential signalling hierarchy between Delta-like 1 and ephrin-B2 ligands, as neural stem cells adopt the Delta-like 1 phenotype of stem cell maintenance on simultaneous presentation of both signals. PMID: 26754526 The results indicate the occurrence of epimutation affecting the IG-DMR and the MEG3-DMR in the two cases, and imply that UPD(14)mat and related (epi)genetic aberrations constitute a rare but important underlying factor for Silver-Russell Syndrome PMID: 25351781 Kaplan-Meier analysis indicated that higher DLK1 levels were associated with shorter survival in Hepatocellular carcinoma (HCC) patients. These results suggest that the serum levels of DLK1 may serve as a prognostic biomarker for HCC patients. PMID: 26018510 Notch pathway activation in endothelial colony forming cells in vivo via co-implanted stromal cells expressing delta-like 1 promotes vasculogenesis. PMID: 25559145 Data show that the median expression of Jagged-1 protein and delta-like 1 protein (Dll-1) was significantly higher in acute myeloid leukemia (AML) blasts than in peripheral blood stem cells (PBSCs). PMID: 24844362 DLK1 expression diminishes during differentiation of human U937 cells to macrophages. PMID: 26115479 Differentiation was comparatively weighted toward the second peak in Delta1 pre-expanded cells. PMID: 23831361 Data show that preadipocyte factor 1 Pref-1 is probably not a major contributor to gestational diabetes mellitus (GDM) pathophysiology but might directly contribute to triglycerides (TG) metabolism, as well as depend on gestational age and renal function. PMID: 25461394 These mice show improved glucose tolerance. Taken together, we conclude Pref-1 as a positive regulator of islet beta-cells and insulin production. PMID: 25918019 Serum levels of Pref-1 were associated with the amount of alcohol consumed during the past 30 days. PMID: 25449367 DLK1 can promote the invasion of lung cancer cells by upregulating MMP9 expression, which depends on Notch signaling PMID: 24621612 DLK1, INSL3 and COUP-TFII expression changes during normal development and is linked to different stages of Leydig Cell differentiation. PMID: 24908673 the microRNA cluster at the Dlk1-Dio3 locus is upregulated in lung adenocarcinoma PMID: 24317514 Pregnancies complicated by gestational diabetes mellitus have decreased fetal pref-1 concentrations compared to normal pregnancies PMID: 24518358 In particular, a locus on chromosome 6 comprises a well-known cluster of imprinted genes including the paternally expressed Dlk1, an atypical Notch ligand PMID: 24676147 DLK1 interacts with the PHB1-PHB2 complex via its cytoplasmic domain and regulates mitochondrial functions, including mitochondrial membrane potential and production of reactive oxygen species. PMID: 24249679 Overall, the data suggest that active expression of the DLK1-DIO3 cluster represents a new biomarker for epigenetic stability of hESCs and indicates the importance of using a proper physiological oxygen level during the derivation and culture of hESCs. PMID: 24123616 We found that, while embryonal rhabdomyosarcomas tumors consistently show LOI of the differentially methylated regions at the DLK1-GTL2 locus, alveolar rhabdomyosarcomas tumors have erasure of imprinting (EOI) at this locus. PMID: 24173021 the imprinted DLK1-DIO3 locus is regulated by noncoding RNA IPW in an induced pluripotent stem cell model of Prader-Willi syndrome PMID: 24816254 These results support a role for microRNAs of DLK1-MEG3 cluster and their epigenetic control by DNA methylation in the pathogenesis of type 2 diabetes mellitus. PMID: 24374217 Elevated Pref-1 concentrations in type 2 diabetes mellitus (T2DM) subjects may contribute to impaired adipose tissue differentiation capacity associated with insulin resistance in obese patients with T2DM. PMID: 23979788 Pref-1 have differential effects on bone mineral density and strength parameters in adolescent athletes compared with non-athletes PMID: 23579340 Dlk1 is a candidate marker for skeletal muscle tumors PMID: 23577150 Primary prostatic cancer-associated fibroblasts (CAFs) were isolated and the expression of CAF markers, Dlk1 and SCUBE1 transcripts were characterised. PMID: 23136397 Placental Pref-1 expression in SGA fetuses was decreased and associated with postnatal body weight, suggesting a role of Pref-1 in the regulation of postnatal development. PMID: 23410724 Paternal methylation aberrations at imprinting control regions of DLK1-GTL2, MEST (PEG1), and ZAC (PLAGL1) and global methylation levels are not associated with idiopathic recurrent spontaneous miscarriages. PMID: 23415968 that alterations in Pref-1 are not involved in the ethiopathogenesis of anorexia nervosa but its changes after partial realimentation could be involved in the regulation of adipose tissue expansion after realimentation. PMID: 22292722 The mRNA expression of TET2 in CD(3)(+) T cells of myelodysplastic syndrome patients was decreased while the mRNA expression of DLK1 was increased. PMID: 22943828 Loss of methylation at the DLK1-MEG3 locus correlates linearly with global loss of DNA methylation in human hepatocellular carcinoma. PMID: 23145177 Reviewed are the microRNAs within the DLK1-DIO3 genomic region, their role in controlling tissue homeostasis and in the pathogenesis of some human diseases, mostly cancer, when aberrantly expressed. [review] PMID: 22825660 DLK1 mRNA levels are higher in MDS patients and lower in AML patients than in healthy individuals. PMID: 22513084 Dlk may regulate the endothelial function in neuroblastic tumors. PMID: 15605081 Delta-like protein seems to be a highly sensitive and specific marker for hepatoblastomas. PMID: 18236070

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.