Recombinant Human Prosurfactant Protein B

Name: Recombinant Human Prosurfactant Protein B
Brand: Beta LifeScience
SKU: BLA-7342P
Availability: InStock

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P07988
Synonym	18 kDa pulmonary-surfactant protein 6 kDa protein PSP B PSPB PSPB_HUMAN Pulmonary surfactant apoprotein PSP-B Pulmonary surfactant-associated protein B Pulmonary surfactant-associated protein, 18-KD Pulmonary surfactant-associated proteolipid SPL(Phe) SFTB3 SFTP3 SFTPB SMDP1 SP B SP-B SPB surfactant protein B Surfactant, pulmonary-associated protein B surfactant-associated protein, pulmonary, 3
Description	Recombinant Human Prosurfactant Protein B was expressed in Wheat germ. It is a Full length protein
Source	Wheat germ
AA Sequence	MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCR ALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQEC NVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEP EQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQ FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLA ERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECH LCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLV PRGWDAHTTCQALGVCGTMSSPLQCIHSPDL
Molecular Weight	69 kDa including tags
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Subcellular Location	Secreted, extracellular space, surface film.
Database References	HGNC: 10801 OMIM: 178640 KEGG: hsa:6439 STRING: 9606.ENSP00000377409 UniGene: Hs.512690
Associated Diseases	Pulmonary surfactant metabolism dysfunction 1 (SMDP1); Respiratory distress syndrome in premature infants (RDS)

Gene Functions References

rs7316 polymorphism associated with respiratory distress syndrome in Iranian premature newborns PMID: 28738720
TGF beta markedly decreased expression of SP-A, SP-B, SP-C, fatty acid synthase, and the phospholipid transporter ABCA3. However, TGF beta increased protein levels of SP-D with little change in mRNA levels. PMID: 29621540
Surfactant protein B suppresses lung cancer progression by inhibiting secretory phospholipase A2 activity and arachidonic acid production. PMID: 28743125
Data show that the thermal transitions observed in N-terminal propeptide of proSP-B (SP-BN) may correspond to the unfolding of certain protein domains or subdomains and/or to oligomers dissociation whereas the overall protein shows resistance to temperature-induced unfolding up to ~ 86 degrees C. PMID: 27380171
SP-A (+186A/G) and SP-B (1580C/T) polymorphisms are strongly associated with the risk of respiratory distress syndrome (RDS) in preterm infants. Notably, reduced serum SP-A levels were correlated with a high risk of RDS and may serve as novel biomarkers for RDS detection and monitoring. PMID: 28011976
Differences were found regarding SPA and pro-SPB expression in the vast majority of subjects: in some lungs, SPA was more expressed whereas in others pro-SPB showed an higher degree of immunoreactivity. The expression of both surfactant proteins was not strictly correlated with gestational age. PMID: 27734990
There is no significant association between the gene polymorphism of the R236C site in exon 7 of SP-B gene and the incidence ofneonatal respiratory distress syndrome (NRDS) in Han populations in that region. PMID: 27655533
Rare mutations in surfactant-associated genes contribute to neonatal respiratory distress syndrome. The frequency of mutations in these genes in the Chinese population is unknown. We resequenced all exons of the surfactant protein-B (SFTPB) and we did not find any rare mutations in SFTPB PMID: 26547207
mice with SP-B-C allele are more susceptible to S. aureus pneumonia than mice with SP-B-T allele, and that CMC2.24 attenuates lung injury thus reducing mortality. PMID: 26863117
In term newborns with pneumonia, SP-B increases with respect to total phospholipids, and disaturated-phosphatidylcholine and is turned over at a faster rate. PMID: 26107393
SP-B -18C/A and 1580C/T polymorphisms are associated with bronchopulmonary dysplasia PMID: 26045806
These results demonstrate for the first time that human SP-B C allele is more susceptible to bacterial pneumonia than SP-B T allele in vivo. PMID: 26620227
Significant differences in frequency of occurrence of unfavorable genotypes CC rs1965708, AA rs1059046 of SFTPA2 gene and CC rs1130866 of SFTPB gene in influenza patients in comparison with individuals of the control group were not detected. PMID: 26950992
Investigated the relationship between SP-A2 and SP-B gene polymorphisms and respiratory distress syndrome in preterm neonates. PMID: 26061924
Given these fact SP-B deficiency may be considered as a further field for research on regenerative therapy i. e. stem cell administration in models of postnatal SP-B deficiency. PMID: 25565191
Results support a critical role of SP-B for promoting pulmonary surface film formation. PMID: 25360829
SFTPB variants are associated with chronic obstructive pulmonary disease susceptibility and lung function in the Chinese Han population. PMID: 25299874
Surfactant protein B gene polymorphism is associated with severe influenza. PMID: 24337193
data support the hypothesis that proSP-B glycosylation due to Ile131Thr variation may have a causal role in genetic susceptibility to acute respiratory distress PMID: 24002332
It was concluded that the polymorphisms of SP-B intron 4 and C/A-18 could be associated with BPD in Chinese Han infants, and the del allele of intron 4 and A allele of C/A-18 might be used as markers of susceptibility in the disease. PMID: 23771654
there was no evidence for any association between common polymorphisms in the SP-B and SP-D genes and COPD risk (all p>0.05). PMID: 24093802
Glucocorticoids mediated surfactant protein B production, maturation, and release is amplified by caffeine. PMID: 24163141
macrophages participate in the repression of SFTPB expression by LPS, and that macrophage-released cytokines (including TNF) regulate the transcription factor CEBPB PMID: 23590297
D2S388-5 microsatellite polymorphism of surfactant protein B may be associated with susceptibility to COPD in Xinjiang Kazakhs. PMID: 23088317
elevated expression in nasal mucosa in chronic rhinosinusitis with polyps PMID: 23406594
Mutations in exon 4 of the surfactant protein B gene demonstrate an association between homozygous mutations with C/C genotype in SP-B gene and neonatal respiratory distress. PMID: 23330012
caffeine is able to induce the expression of SP-transcription factors and affects the signaling pathways of glucocorticoids, amplifying their effects PMID: 23272120
The results indicate that tryptophan oxidation causes substantial disruptions in helical structure and lipid interactions. PMID: 21128671
review focuses on published association studies of surfactant proteins A and D genetic polymorphisms with respiratory, and non-respiratory diseases in adults, children, and newborns [review] PMID: 22201752
The present study demonstrated that the AG genotype of AG 9306 polymorphism was a protective factor against the development of respiratory distress syndrome, other polymorphisms studied (G/C at 8714, C/T at 1580, A/C at -18) were not associated with RDS. PMID: 21180884
In patients undergoing major vascular abdominal surgery, SP-B values increase progressively during mechanical ventilation stages compared to advanced glycation end-products (RAGE) kinetics. PMID: 21736957
SP-B 1580C/T polymorphism contributes to the etiology of respiratory distress syndrome. PMID: 22289747
Circulating levels of SP-B increase with greater smoking burden and independently associate with abdominal abdominal aortic plaque among current smokers. PMID: 21817103
Genetic variations in the gene coding for surfactant protein B are associated with more severe lung injury as indicated by the association of specific single nucleotide polymorphism genotypes and haplotypes PMID: 21283003
Surfactant protein B and RAGE increases in the plasma during cardiopulmonary bypass PMID: 20650982
Surfactant protein B polymorphisms have a role in pulmonary function and COPD PMID: 20693256
Disaturated-phosphatidylcholine and surfactant protein-B have a different turnover both in healthy and diseased lungs. PMID: 21429235
Absence of this protein resulted in Congenital pulmonary alveolar proteinosis in two newborn children PMID: 20005435
Surfactant protein-B 121ins2 heterozygosity is associated with reduced lung function and increased risk for COPD among smokers PMID: 19833825
review of lipid-protein interactions of hydrophobic proteins SP-B and SP-C in lung surfactant assembly and dynamics PMID: 11699574
Data suggest that SMAD3 interactions with the positive regulators NKX2.1 and HNF-3 underlie the molecular basis for TGF-beta-induced repression of surfactant protein B gene transcription. PMID: 12161428
role of Differences in N-linked glycosylation between human surfactant protein-B variants of the C or T allele at the single-nucleotide polymorphism at position 1580 in disease PMID: 12356334
suggest that polymorphisms in intron 4 of the surfactant protein B gene independently modify the course of neonatal respiratory distress syndrome PMID: 12424586
An association between SP-B polymorphism and RDS was found in premature, first-born twins. In particular, the threonine allele was associated with an increased risk of RDS. PMID: 12483294
dimeric SP-B(1-25) is more efficient in restoring lung function in neonatal RDS and ARDS than monomeric SP-B(1-25) surfactant. PMID: 12490037
surfactant protein B expression is regulated by an enhancer region which binds to thyroid transcription factor-1, retinoic acid receptor, signal transducers and activators of transcription 3, nuclear receptor coactivators (SRC-1, ACTR, TIF2, and CBP/p300 PMID: 12573987
Mutataions and Polymorphisms in SFTPB is associated with severe unexplained respiratory distress PMID: 12784301
SP-B expression is regulated by PPARgamma in the lung PMID: 12829715
Reduced SP-B expression due to elevated nitric oxide levels can contribute to lung injury. PMID: 12896877
In human lungs, mature SP-B is involved in the structural organization of lamellar bodies and tubular myelin by the formation of core particles. PMID: 12972403

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.