Recombinant Human Prostate Stem Cell Antigen (PSCA) Protein (His)

Name: Recombinant Human Prostate Stem Cell Antigen (PSCA) Protein (His)
Brand: Beta LifeScience
SKU: BLC-04619P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Prostate Stem Cell Antigen (PSCA) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O43653
Target Symbol	PSCA
Synonyms	PSCA; UNQ206/PRO232; Prostate stem cell antigen
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
Expression Range	12-86aa
Protein Length	Full Length of Mature Protein
Mol. Weight	9.7 kDa
Research Area	Tags & Cell Markers
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.; May act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits nicotine-induced signaling probably implicating alpha-3:beta-2- or alpha-7-containing nAChRs.
Subcellular Location	Cell membrane; Lipid-anchor, GPI-anchor.
Database References	HGNC: 9500 OMIM: 602470 STRING: 9606.ENSP00000301258 UniGene: PMID: 29892961 Men with the rs1045531 AC genotype of prostate stem cell antigen(PSCA) were at higher risk of prostate cancer in Chinese patients undergoing prostate biopsy. PMID: 29332451 Study shows that PSCA gene is a target of 8q24 locus in Invasive micropapillary carcinoma (IMPC) of the breast, and the PSCA gene amplification results in PSCA protein overexpression. These results demonstrate an independently worse prognosis for PSCA overexpression in IMPC, and suggest that the differential expression of PSCA is associated with cell adhesion molecules in breast cancer. PMID: 28755148 the PSCA rs2294008 polymorphism may serve as a biomarker of cervical cancer, particularly of early-stage cervical cancer PMID: 27001215 The expression of Ki-67, PSCA, and Cox-2 biomarkers along with other clinicopathologic factors were prognostic factors for biochemical recurrence in patients with clinically localized prostate cancer following radical prostatectomy PMID: 27232854 Among Chinese Han women, the PSCA rs2294008, rs2978974, and rs2976392 minor alleles are associated with increased breast cancer risk especially in progesterone receptor positive breast cancer patients, with breast cancer risk in postmenopausal women, and with high lymph node metastasis risk, respectively. PMID: 27050280 PSCA is a novel cell cycle regulator with a key role in prostate cancer cell proliferation. PMID: 28971496 PSCA regulates IL-6 expression through p38/NF-kappaB signaling in Prostate cancer. PMID: 28845520 the results indicated that the PSCA rs2294008 T and rs2976392 A alleles were low-penetrate risk factors for gastric cancer in this study population. PMID: 26848528 analysis of PSCA level in the peripheral blood of PC patients who underwent radical prostatectomy shows it is related to a GADPH reference level (PSCA/GAPDH ratio) PMID: 26527100 our data provide a novel molecular mechanism for the tumor suppressor role of PSCA PMID: 26785734 suggest that PSCA is a useful tissue marker for predicting biochemical recurrence in patients with high risk PC receiving NHT and radical prostatectomy PMID: 26982980 Genetic Variants of PSCA Gene are not Associated with Colorectal Cancer. PMID: 26320491 we show that PSCA is a key player in nasopharyngeal carcinoma metastasis PMID: 26147638 PSCA rs2294008 Polymorphism is associated with Increased Risk of Cancer PMID: 26308216 PSCA has a promoting role in the growth and metastasis of prostate cancer. PMID: 26477693 PSCA mRNA is overexpressed in the peripheral blood of prostate cancer patients. PMID: 25698533 These results suggest that PSCA gene variation has a potential effect on its expression and gastric adenocarcinoma risk in the Northwest Chinese population. PMID: 26006239 a significantly increased stomach cancer risk was associated with PSCA SNPs rs2294008 and s2976392 in a Han Chinese population. PMID: 25658482 Studied six SNP loci: (rs2279115 of BCL2 gene, rs804270 of NEIL2 gene, rs909253 of LTA gene, rs2294008 of PSCA gene, rs3765524 and rs10509670 of PLCE1 gene) to evaluate gastric cancer risk using magnetic nanoparticles and universal tagged arrays. PMID: 26554163 The PSCA rs2294008 C>T polymorphism may be acting through induction of gastric mucosal atrophy, finally leading to development of gastric ulcer and gastric cancer in PSCA rs2294008 T allele carriers with Helicobacter infections. PMID: 25582162 The PSCA rs2294008 polymorphism is involved in the susceptibility to GC and DU. PMID: 25721731 PSCA signaling may suppress tumor growth in vivo by modulating immunological characteristics of gallbladder cancer cells. PMID: 25964537 In the Han Chinese population, genetic variation in PSCA was significantly correlated with susceptibility to colorectal cancer. PMID: 24557062 rs2294008 polymorphism in the PSCA gene is associated with the risk of bladder cancer. PMID: 25374226 the results suggest that the PSCA rs2294008 (C>T) polymorphism is a risk factor for bladder cancer development. PMID: 25117309 PSCA rs2294008 allele A & T was linked with risk of gastric cancer and high-risk gastritis PMID: 25503145 Accumulating evidence shows an association of PSCA with cancers, such as prostate, gastric, bladder, and pancreatic cancer; however, its expression varies with different cancer types. PMID: 24308679 PSCA is not a marker for a stem cell population nor is it exclusively expressed in the prostate; the function of PSCA in normal cellular processes or carcinogenesis is currently unknown PMID: 24320701 expression of PSCA as a cell surface marker increased from benign prostate tissues and High Grade Prostatic Intraepithelial Neoplasias to prostate cancer PMID: 24183365 PSCA-chimeric antigen receptor T cells may be developed for treatment of prostate cancer. PMID: 24438073 the T allele of rs2294008, an intronic variant of the PSCA gene at 8q24 that was previously associated with an increased risk of gastric cancer, was inversely associated with a decreased risk of esophageal squamous cell carcinoma. PMID: 24654646 Our findings demonstrated that rs2294008 and rs2976392 polymorphism of PSCA is a risk-conferring factor associated with increased gastric cancer susceptibility PMID: 24146278 no clearcut interaction with PSCA SNPs in defining risk of gastric precancerous lesions or cancer PMID: 24023815 Overexpression of PSCA and Oct-4 might be closely related to the carcinogenesis, progression, metastasis, or invasive potential and prognosis of gallbladder carcinoma. PMID: 23984394 Data indicate that PSA, PSMA, hK2, PSCA, DD3, and their combinations, combined analysis of PSA and/or hK2 expression in pelvic lymph nodes could predict biochemical recurrence free survival (BRFS) following radical prostatectomy (RP). PMID: 21600799 A C-allele of rs2294008 at PSCA increased the risk of gastric ulcer. PMID: 23704932 A significant association has been found between the PSCA Trs2294008-Grs2978974 haplotype and higher risk of gallbladder carcinoma in females, whereas this haplotype conferred significantly lower risk to males. PMID: 23988503 Of the 10 target genes, PCA3 and PSCA mRNAs were significantly differently expressed in cancerous tissue than in histologically benign tissue of cancerous prostates PMID: 23391636 Data indicate that RNA silencing of PSCA can inhibit the proliferation and invasiveness properties of prostate cancer PC-3M cells, which may provide a promising therapeutic strategy for prostate cancer. PMID: 21429770 Results indicate the importance of four gastric cancer susceptibility polymorphisms of IL-10, NOC3L, PSCA and MTRR in the Chinese Han population. PMID: 22796266 a genotyping study to assess for associations between the PSCA rs2294008 polymorphism and risk of adenomatous polyps and colorectal cancer PMID: 22824379 study suggested rs2294008 in the PSCA gene to be associated with increased risk of gastric cancer and rs2070803 in MUC1 to play a protective role in a Chinese population PMID: 22938426 findings suggest that the PSCA rs2294008 C>T polymorphism is a risk factor for gastric cancer, especially in diffuse and noncardia gastric cancer and in Chinese PMID: 22938475 The two loci of PSCA (rs2294008 and rs2976392) were both significantly associated with gastric cancer susceptibility and in linkage disequilibrium. PMID: 22426141 intensity of QDs fluorescence remained stable for two weeks (p = 0.083) after conjugation to the PSCA protein, and nearly 93% of positive expression with their fluorescence still could be seen after four weeks PMID: 22778595 Findings suggest that prostate stem cell antigen (PSCA) rs2294008 C > T and rs2976392 G > A polymorphisms may contribute to the susceptibility to gastric cancer, particular in non-cardia or diffused gastric cancer. PMID: 22481254 Associations exist between PSCA SNPs and breast cancer susceptibility in Korean women PMID: 22502712 PSCA is acting as a tumor suppressor in GBC development. PMID: 21936014 The C allele of rs2294008 at PSCA was associated with increased risk of duodenal ulcer in a recessive model but was associated with decreased risk of gastric cancer. PMID: 22387998

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Prostate Stem Cell Antigen (PSCA) Protein (His)

Recombinant Human Prostate Stem Cell Antigen (PSCA) Protein (His)

Product Overview

Target Details

FAQs