Recombinant Human Prostate Stem Cell Antigen (PSCA) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-04327P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Prostate Stem Cell Antigen (PSCA) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-04327P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Prostate Stem Cell Antigen (PSCA) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O43653 |
| Target Symbol | PSCA |
| Synonyms | PSCA; UNQ206/PRO232; Prostate stem cell antigen |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS |
| Expression Range | 12-86 aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 35.7kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.; May act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits nicotine-induced signaling probably implicating alpha-3:beta-2- or alpha-7-containing nAChRs. |
| Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. |
| Database References | HGNC: 9500 OMIM: 602470 STRING: 9606.ENSP00000301258 UniGene: PMID: 29892961 |
