Recombinant Human ProSAAS Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-7330P
Recombinant Human ProSAAS Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-7330P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9UHG2 |
Synonym | b-LEN b-PEN-LEN b-SAAS Big LEN granin like neuroendocrine peptide l-LEN l-SAAS N-proSAAS OTTHUMP00000032426 PCSK1_HUMAN Pcsk1n pro-SAAS Proprotein convertase 1 inhibitor Proprotein convertase subtilisin/kexin type 1 inhibitor PROSAAS SAAS SAAS CT(1-49) SAAS CT(25-40) |
Description | Recombinant Human ProSAAS Protein (denatured) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMARPVKEPRGLSAASPPLAETGAPRRF RRSVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQL LRVWGAPRNSDPALGLDDDPDAPAAQLARALLRARLDPAALAAQLVPAPV PAAALRPRPPVYDDGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADS EGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLP P |
Molecular Weight | 27 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |