Recombinant Human Prealbumin Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-7274P
Recombinant Human Prealbumin Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-7274P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P02766 |
Synonym | Amyloid polyneuropathy Amyloidosis I ATTR Carpal tunnel syndrome 1 CTS CTS1 Dysprealbuminemic euthyroidal hyperthyroxinemia Dystransthyretinemic hyperthyroxinemia Epididymis luminal protein 111 HEL111 HsT2651 PALB Prealbumin Prealbumin amyloidosis type I Prealbumin Thyroxine-binding Senile systemic amyloidosis TBPA Thyroxine binding prealbumin Transthyretin TTHY_HUMAN TTR TTR protein |
Description | Recombinant Human Prealbumin Protein (Tagged) was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTS ESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDS GPRRYTIAALLSPYSYSTTAVVTNPKE |
Molecular Weight | 15 kDa |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |