Recombinant Human PPP2R2D Protein
Beta LifeScience
SKU/CAT #: BLA-7243P
Recombinant Human PPP2R2D Protein
Beta LifeScience
SKU/CAT #: BLA-7243P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | 2ABD_HUMAN MDS026 PP2A subunit B isoform B55-delta PP2A subunit B isoform delta PP2A subunit B isoform PR55-delta PP2A subunit B isoform R2-delta PPP2R2D Protein phosphatase 2 regulatory subunit B delta Protein phosphatase 2 regulatory subunit B delta isoform Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform |
Description | Recombinant Human PPP2R2D Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MDLMVEASPRRIFANAHTYHINSISVNSDHETYLSADDLRINLWHLEITD RSFNIVDIKPANMEELTEVITAAEFHPHQCNVFVYSSSKGTIRLCDMRSS ALCDRHSKFFEEPEDPSSRSFFSEIISSISDVKFSHSGRYMMTRDYLSVK VWDLNMESRPVETHQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSAIMT GSYNNFFRMFDRDTRRDVTLEASRESSKPRASLKPRKVCTGGKRRKDEIS VDSLDFNKKILHTAWHPVDNVIAVAATNNLYIFQDKIN |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |