Recombinant Human PNAD Protein
Beta LifeScience
SKU/CAT #: BLA-7151P
Recombinant Human PNAD Protein
Beta LifeScience
SKU/CAT #: BLA-7151P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | N terminal Asn amidase N terminal asparagine amidase N terminal asparagine amidohydrolase NTAN1 NTN-amidase PNAA PNAD Protein N-terminal Asn amidase Protein N-terminal asparagine amidase Protein N-terminal asparagine amidohydrolase Protein NH2-terminal asparagine amidohydrolase Protein NH2-terminal asparagine deamidase Protein NTN-amidase |
Description | Recombinant Human PNAD Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MPLLVEGRRVRLPQSAGDLVRAHPPLEERARLLRGQSVQQVGPQGLLYVQ QRELAVTSPKDGSISILGSDDATTCHIVVLRHTGNGATCLTHCDGTDTKA EVPLIMNSIKSFSDHAQCGRLEVHLVGGFSDDRQLSQKLTHQLLSEFDRQ EDDIHLVTLCVTELNDREENENHFPVIYGIAVNIKTAEIYRASFQDRGPE EQLRAARTLAGGPMISIYDAETEQLRIGPYSWTPFPHVDFWLHQDDKQIL ENLSTSPLAEPPHFVEHIRSTLMFLKKHPSPAHTLFSGNKALLYKKNEDG LWEKISSPGS |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |