Recombinant Human Plastin L Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-7100P
Recombinant Human Plastin L Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-7100P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P13796 |
Synonym | CP64 L plastin L-plastin Larval cuticle protein 1 LC64P LCP-1 LCP1 LPL Lplastin Lymphocyte cytosolic protein 1 Plastin 2 Plastin-2 PLS2 PLSL_HUMAN |
Description | Recombinant Human Plastin L Protein (His tag) was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | ARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVR EITENLMATGDLDQDGRISFDEFIKIFHGLKSTDVAKTFRKAINKKEGIC AIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTN DLFNAVGDGIVLCKMINLSVPDTIDERTINKKKLTPFTIQENLNLALNSA SAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIAL LREGESLEDLMKLSPEELLLRWANYHLENAGCNKIGNFSTDIKDSKAYYH LLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVT ATDVVRGNPKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFR NWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVPVDWNRVNKPPYPKLG GNMKKLENCNYAVELGKNQAKFSLVGIGGQDLNEGNRTLTLALIWQLMRR YTLNILEEIGGGQKVNDDIIVNWVNETLREAKKSSSISSFKDPKISTSLP VLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALP EDLVEVNPKMVMTVFACLMGKGMKRV |
Molecular Weight | 72 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Actin-binding protein. Plays a role in the activation of T-cells in response to costimulation through TCR/CD3 and CD2 or CD28. Modulates the cell surface expression of IL2RA/CD25 and CD69. |
Subcellular Location | Cytoplasm, cytoskeleton. Cell junction. Cell projection. Cell projection, ruffle membrane; Peripheral membrane protein; Cytoplasmic side. |
Database References | |
Associated Diseases | Chromosomal aberrations involving LCP1 is a cause of B-cell non-Hodgkin lymphomas (B-cell NHL). Translocation t(3;13)(q27;q14), with BCL6. |
Tissue Specificity | Detected in intestinal microvilli, hair cell stereocilia, and fibroblast filopodia, in spleen and other lymph node-containing organs. Expressed in peripheral blood T-lymphocytes, neutrophils, monocytes, B-lymphocytes, and myeloid cells. |
Gene Functions References
- LCP1-positive oral squamous cell carcnome samples were correlated closely with the primary tumor size and regional lymph node metastasis. PMID: 28230172
- MOLP8/R cells display a very high overexpression of LCP1 gene (l-Plastin) controlled by HIF1&alpha. PMID: 29882856
- these findings support a plausible mechanism by which the AP4/L-plastin axis is regulated by the PI3K/AKT pathway in human prostate cancer (PCa)and may represent a novel therapeutic target in PCa treatment. PMID: 28981098
- Mutated LCP1 is a driver of chronic lymphocytic leukemia. PMID: 28679620
- AngII-dependent phosphorylation of LCP1 in cultured podocytes was mediated by the kinases ERK, p90 ribosomal S6 kinase, PKA, or PKC. LCP1 phosphorylation increased filopodia formation. PMID: 28768720
- L-plastin regulates the stability of the immune synapse of naive and effector T-cells. (Review) PMID: 27720134
- The findings support a mechanism in which miR-375 suppresses RUNX1 levels, resulting in reduced vimentin and L-plastin expression. Knockdown of RUNX1, L-plastin, and vimentin resulted in significant reductions in cell invasion in vitro, indicating the functional significance of miR-375 regulation of specific proteins involved in head and neck squamous cell carcinoma (HNSCC) invasion. PMID: 28499703
- In this study, the authors found that the actin filament bundling abilities of PLS1 and PLS2 were similarly sensitive to Ca(2+) (pCa50 ~6.4), whereas PLS3 was less sensitive (pCa50 ~5.9). PMID: 28694070
- elevated L-plastin expression promotes elongation and reduces protrusion density in cells with relatively lower L-plastin than fascin levels. PMID: 26945069
- Enhanced nitroxidative stress may results in LPL S-glutathionylation leading to impaired chemotaxis, polarization, and bactericidal activity of human neutrophils. PMID: 25881549
- association of SNPs in LCP1 and CTIF with hearing PMID: 26264041
- An NKX3.1 binding site polymorphism in the l-plastin promoter leads to differential gene expression in human prostate cancer PMID: 26148677
- The proteins (HSP90b, TSM1 and L-plastin) in the current study may hold potential in differentiating between melanoma and benign nevi in diagnostically challenging cases. PMID: 25191796
- Data suggest that several single-nucleotide polymorphisms (SNPs) of the plastin genes PLS3 and LCP1 could serve as gender- and/or stage-specific molecular predictors of tumor recurrence in stage II/III colorectal cancer as well as therapeutic targets. PMID: 24170770
- L-plastin plays an important role in the clustering of NKG2D into lipid rafts, and it participates in NKG2D-mediated inhibition of NK cell chemotaxis. PMID: 24803550
- expression of L-plastin promotes tumor metastasis and, importantly, that this effect depends on an additionally required phosphorylation of L-plastin PMID: 24438191
- L-plastin is indispensable for podosome formation and function in macrophages. PMID: 24236012
- LCP1 is functionally relevant to CXCL12 induced B-cell migration. PMID: 24009233
- High serum LCP1 is associated with kidney cancer. PMID: 23479363
- Hepatic LCP1 mRNA was increased (by 300%) in liver biopsy samples from patients with nonalcoholic fatty liver disease compared to controls PMID: 23213074
- This study adds L-plastin to a growing list of proteins implicated in T lymphocyte polarity and migration PMID: 22581862
- our data introduce costimulation-induced L-plastin phosphorylation as an important event for immune synapse formation and its inhibition by dexamethasone as a novel mode of function of this immunosuppressive glucocorticoid. PMID: 21805466
- Results establish a causative role for PKCbetaII and L-plastin in linking GM-CSF-induced eosinophil priming for chemotaxis. PMID: 21525390
- Plasmic L-plastin level in patients with colorectal cancer was higher than that in healthy adults, and was associated with tumor size, penetration, and lymphatic metastasis. PMID: 20878578
- required for immune synapse formation PMID: 20683899
- This study discloses a novel unexpected role of the actin bundling protein L-plastin as a cell protective protein against TNF-cytotoxicity. PMID: 19799649
- Data demonstrate for the first time that L-plastin contributes to the fine-tuning of actin turn-over, an activity which is regulated by Ser5 phosphorylation promoting its high affinity binding to the cytoskeleton. PMID: 20169155
- Data show that the serine protease plasmin cleaved both propeptides from human vascular endothelial growth factor (VEGF)-D, generating mature forms, and also activated VEGF-C. PMID: 12963694
- association of L-plastin overexpression with increased rate of proliferation and invasion, and loss of E-cadherin expression in the SW480 colon cancer cell line indicates that L-plastin plays an important mechanistic role in colorectal cancer metastasis PMID: 16287074
- Data suggest that phosphorylated L-plastin might act as an integrator of signals controlling the assembly of the actin cytoskeleton and cell motility in a 3D-space. PMID: 16636079
- Data show that an increase in melanoma cell invasiveness requires not only expression but also phosphorylation of L-plastin. PMID: 17290393
- Phosphorylation of the actin bundling protein L-plastin represents a mechanism by which costimulation controls the transport of activation receptors to the T cell surface. PMID: 17294403
- L-plastin and S100A9 were differentially expressed in nasopharyngeal carcinoma and normal nasopharyngeal epithelial tissue PMID: 19142861