Recombinant Human Placental alkaline phosphatase (PLAP) Protein

Beta LifeScience SKU/CAT #: BLA-6979P

Recombinant Human Placental alkaline phosphatase (PLAP) Protein

Beta LifeScience SKU/CAT #: BLA-6979P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession P05187
Synonym Alkaline phosphatase Alkaline phosphatase placental Alkaline phosphatase placental type Alkaline phosphatase Regan isozyme ALP Alp1 ALPP FLJ61142 Germ-cell alkaline phosphatase nagao isozyme OTTHUMP00000164354 PALP Placental alkaline phosphatase 1 placental heat-stable alkaline phosphatase placental type PLAP PLAP-1 PLAP1 PPB1_HUMAN
Description Recombinant Human Placental alkaline phosphatase (PLAP) Protein was expressed in HEK293. It is a Full length protein
Source HEK293
AA Sequence IIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVT AARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYL CGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTR VQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVIL GGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNR TELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLS RNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDT LSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYV LKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVH GVQEQTFIAHVMAFAACLEPYTACDLAPPAGTTDVDHHHHHH
Molecular Weight 54 kDa including tags
Purity >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Alkaline phosphatase that can hydrolyze various phosphate compounds.
Subcellular Location Cell membrane; Lipid-anchor, GPI-anchor.
Protein Families Alkaline phosphatase family
Database References
Tissue Specificity Detected in placenta (at protein level).

Gene Functions References

  1. This meta-analysis suggests that high serum ALP level is obviously associated with lower OS rate in patients with osteosarcoma, and it is an effective biomarker of prognosis. PMID: 29970708
  2. Concentrations of PLAP were elevated in gingival crevicular fluid of patients with pre-eclampsia. PMID: 26988336
  3. SALL4 also outperformed PLAP on a small sample of cytology blocks. Although SALL4 is not entirely specific, it is a highly sensitive marker with strong diffuse nuclear reactivity in the majority of MGCTs in the posttreatment setting, at significantly higher levels than PLAP PMID: 25906119
  4. Quantum-mechanical computational methods were employed to study the catalytic mechanism of human placental AP (PLAP). An active-site model was used, constructed on the basis of the X-ray crystal structure of the enzyme. PMID: 25409280
  5. term placental explants, but not their conditioned medium, can de-phosphorylate IGFBP-1 through the action of placental alkaline phosphatase PMID: 24856042
  6. Anti-PLAP antibodies may serve as a modular building blocks for the development of targeted therapeutic products, armed with cytotoxic drugs, radionuclides or cytokines as payloads. PMID: 24247025
  7. A candidate gene, ALPP, encoding the placental alkaline phosphatase, was identified as being potentially involved in recurrent spontaneous abortion. PMID: 24296104
  8. The objective of the following study was to record the specificity and sensitivity of alpha5(IV) loss, smoothelin expression and PLAP expression as markers of gastrointestinal smooth muscle neoplasms PMID: 24043717
  9. Data indicate that p180 is required for the efficient targeting of placental alkaline phosphatase (ALPP) mRNA to the endoplasmic reticulum (ER). PMID: 24019514
  10. Calculation of the electrostatic potentials within the active site of human placental alkaline phosphatase also suggests that the local positive electrostatic environment may account for its capability to distinguish various substrates PMID: 21910833
  11. High serum alkaline phosphatase cooperating with MMP-9 is associated with metastasis in patients with primary osteosarcoma. PMID: 22333159
  12. PLAP exerts a positive effect on DNA replication and acts as a proliferative factor in trophoblastic cells. PMID: 21868091
  13. The proximity of undifferentiated gonadal tissue with the tumors as well as the immunostaining patterns (PLAP+, OCT3/4+, and CD117/KIT+) suggests that germ cells found in them are a risk factor for gonadal tumors. PMID: 21692598
  14. the catalytic mechanism of human placental alkaline phosphatase PMID: 21939286
  15. Data show that serum alkaline phosphatase, Gleason score, and intensity of bone metastasis are important and statistically significant prognostic factors, and affects time to progression and life time. PMID: 19450995
  16. at a certain time point during adrenocortical development, some fetal zone cells survive owing to defective apoptosis and develop into childhood ACT, maintaining some characteristics of the embryonal period, such as PLAP expression PMID: 21516013
  17. Serum total calcium (r -0.1362, p<0.001), serum inorganic phosphate (r -0.45, p<0.001) and serum alkaline phosphatase (r -0.5587, p<0.001) have shown inverse relationship with age. PMID: 20655896
  18. High serum alkaline phosphatase is associated with chronic kidney disease. PMID: 20299338
  19. differential expression of Pl(1) and Pl(2) probably results from linkage disequilibrium with the sequence variation rs2014683G>A in the ALPP gene promoter that was shown to have allele-specific binding patterns to placental nuclear proteins. PMID: 20663553
  20. structure of placental alkaline phosphatase with pNPP contained only p-nitrophenol in three distinct sites, while the structure with 5'-AMP contained the p-nitrophenyl group in two of the sites instead of 5'-AMP PMID: 20693656
  21. Low magnitudes of tensile strain enhance expression of alkaline phosphatase in human osteoblasts. PMID: 19595020
  22. The PLAP D allele contains two amino acid substitutions: P209R (692C>G) and E429G (1352 A>G). PMID: 11857742
  23. Proximity of the protein moiety of a GPI-anchored protein to the membrane surface: a FRET study. PMID: 12081485
  24. the beta-N-acetylglucosaminyl phosphate diester residue is attached to the glycosylphosphatidylinositol anchor of human placental alkaline phosphatase and is a target of the channel-forming toxin aerolysin PMID: 12851398
  25. receptor for Aeromonas sobria hemolysin. PMID: 15715171
  26. analysis of human placental alkaline phosphatase in complex with functional ligands PMID: 15946677
  27. The effect of parity on placental weight and birth weight is examined through a series of birth records from an Indian population in Calcutta. PMID: 16431676
  28. crystal structure of strontium-substituted human placental alkaline phosphatase shows that strontium substitutes the calcium ion with concomitant modification of the metal coordination PMID: 16815919
  29. activity of GPI-anchored enzymes may be modulated by membrane microenvironment features PMID: 18416535
  30. Serum bilirubin, alkaline phosphatase, and aspartate aminotransferase are an efficient set of biochemistries to identify UDCA-treated patients with primary biliary cirrhosis at risk of death or liver transplantation (LT). PMID: 18752324
  31. Elevations of alkaline phosphatase is associated with therapy related pediatric cancer. PMID: 18802949

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

More from Other Recombinant Proteins
Greater than 90% as determined by SDS-PAGE.
Recombinant Juniperus Ashei Pectate Lyase 1
  • Molecule: Pectate Lyase 1;
  • Species: Juniperus ashei ;
  • Expression system: Yeast;
  • Tag: Tag-Free;
  • Sequence: Full Length Protein;
CAT#: BLC-02231P

Online Inquiry
Greater than 90% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Acyl-Coa-Binding Protein (ACB1) Protein (His)
  • Molecule: ACB1;
  • Species: Yeast;
  • Expression system: Yeast;
  • Tag: His;
  • Sequence: Full Length Protein;
CAT#: BLC-08185P

Online Inquiry
Greater than 90% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 μg/ml can bind human PEX19, the EC 50 of human PEX19 is 22.96-33.00 μg/ml.
Recombinant Human Atp-Binding Cassette Sub-Family D Member 1 (ABCD1) Protein (His), Active
  • Molecule: ABCD1;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: His;
  • Sequence: Full Length Protein;
CAT#: BLC-05645P

Online Inquiry
Greater than 85% as determined by SDS-PAGE.
Recombinant Acinetobacter Baumannii Efflux Pump Membrane Transporter (HMPREF0010_00594) Protein (His)
  • Molecule: HMPREF0010_00594;
  • Species: Acinetobacter baumannii ;
  • Expression system: E.coli;
  • Tag: His;
  • Sequence: Full Length Protein;
CAT#: BLC-00395P

Online Inquiry
Greater than 90% as determined by SDS-PAGE.
Recombinant Ctenocephalides Felis Salivary Antigen 1 Protein (His-SUMO)
  • Molecule: Salivary Antigen 1;
  • Species: Ctenocephalides felis ;
  • Expression system: E.coli;
  • Tag: His-SUMO;
  • Sequence: Full Length Protein;
CAT#: BLC-08547P

Online Inquiry
Greater than 90% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized OMA1 at 5 μg/ml can bind human BZW2, the EC 50 of human BZM2 is 45.42-72.22 μg/ml.
Recombinant Human Metalloendopeptidase Oma1, Mitochondrial (OMA1) Protein (His-SUMO), Active
  • Molecule: OMA1;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: His-SUMO;
  • Sequence: Full Length Protein;
CAT#: BLC-05648P

Online Inquiry
Recently viewed