Recombinant Human PKA R2/PKR2 Protein
Beta LifeScience
SKU/CAT #: BLA-7052P
Recombinant Human PKA R2/PKR2 Protein
Beta LifeScience
SKU/CAT #: BLA-7052P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9BUB1 |
Synonym | cAMP dependent protein kinase regulatory subunit alpha 2 cAMP dependent protein kinase regulatory subunit RII alpha cAMP dependent protein kinase type II alpha regulatory chain cAMP dependent protein kinase type II alpha regulatory subunit cAMP-dependent protein kinase type II-alpha regulatory subunit KAP2 KAP2_HUMAN MGC3606 PKR 2 PKR2 PRKA R2 PRKAR 2 PRKAR2 PRKAR2A Protein kinase A RII alpha subunit Protein kinase cAMP dependent regulatory type II alpha |
Description | Recombinant Human PKA R2/PKR2 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVL PAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSV CAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQ VLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQY DNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRK MFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQTKSNKDGGN QEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLG PCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ |
Molecular Weight | 70 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |