Recombinant Human PIM3 Protein
Beta LifeScience
SKU/CAT #: BLA-7021P
Recombinant Human PIM3 Protein
Beta LifeScience
SKU/CAT #: BLA-7021P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q86V86 |
Synonym | Kid 1 Kid1 Kinase induced by depolarization ONCOGENE PIM3 PIM 3 Pim 3 oncogene Pim-3 proto-oncogene, serine/threonine kinase PIM3 Pim3 oncogene PIM3_HUMAN Protein kinase Kid 1 Protein kinase Kid1 Serine/threonine kinase Pim 3 Serine/threonine kinase Pim3 Serine/threonine protein kinase Pim 3 Serine/threonine protein kinase Pim3 Serine/threonine-protein kinase Pim-3 |
Description | Recombinant Human PIM3 Protein was expressed in Baculovirus infected Sf9 cells. It is a Full length protein |
Source | Baculovirus infected Sf9 cells |
AA Sequence | MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGG FGTVYAGSRIADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLRKVGAA GGARGVIRLLDWFERPDGFLLVLERPEPAQDLFDFITERGALDEPLAR RFFAQVLAAVRHCHSCGVVHRDIKDENLLVDLRSGELKLIDFGSGALLKD TVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQD EEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADG GVPESCDLRLCTLDPDDVASTTSSSESL |
Molecular Weight | 65 kDa including tags |
Purity | >90% Densitometry. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The specific activity is 900 mol/min/mg. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |