Recombinant Human PI 3 Kinase p110 delta Protein
Beta LifeScience
SKU/CAT #: BLA-6971P
Recombinant Human PI 3 Kinase p110 delta Protein
Beta LifeScience
SKU/CAT #: BLA-6971P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | 5-bisphosphate 3-kinase 110 kDa catalytic subunit delta 5-bisphosphate 3-kinase catalytic subunit delta isoform APDS GRB1 IMD14 p110d p110delta p110dp85a p85-ALPHA Phosphatidylinositol 3 kinase catalytic delta polypeptide Phosphatidylinositol 4 5 bisphosphate 3 kinase catalytic subunit delta isoform Phosphatidylinositol 4,5 bisphosphate 3 kinase 110 kDa catalytic subunit delta Phosphatidylinositol 4,5 bisphosphate 3 kinase, catalytic subunit delta Phosphatidylinositol 45 bisphosphate 3 kinase catalytic subunit delta isoform Phosphatidylinositol-4 Phosphoinositide 3 kinase B Phosphoinositide 3 kinase C Phosphoinositide 3 kinase catalytic delta polypeptide Phosphoinositide 3 kinase, catalytic, delta polypeptide variant p37delta PI3 kinase p110 subunit delta PI3-kinase subunit delta PI3K PI3K-delta PI3Kdelta Pik3cd PIK3R1 PK3CD PK3CD_HUMAN PtdIns 3 kinase p110 PtdIns 3 kinase subunit p110 delta PtdIns-3-kinase subunit delta PtdIns-3-kinase subunit p110-delta |
Description | Recombinant Human PI 3 Kinase p110 delta Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | DFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPN RALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPE DYTLQVNGRH |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |