Recombinant Human PI 3 Kinase p110 alpha + PI 3 kinase p85 alpha (mutated N345 K) Protein
Beta LifeScience
SKU/CAT #: BLA-6967P
Recombinant Human PI 3 Kinase p110 alpha + PI 3 kinase p85 alpha (mutated N345 K) Protein
Beta LifeScience
SKU/CAT #: BLA-6967P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P27986P42336 |
Synonym | GRB1 MGC142161 MGC142163 p110 alpha p85 p85 alpha Phosphatidylinositol 3 kinase 85 kDa regulatory subunit alpha Phosphatidylinositol 3 kinase associated p 85 alpha Phosphatidylinositol 3 kinase catalytic 110 KD alpha Phosphatidylinositol 3 kinase catalytic alpha polypeptide Phosphatidylinositol 3 kinase regulatory 1 Phosphatidylinositol 3 kinase regulatory subunit alpha Phosphatidylinositol 3 kinase regulatory subunit polypeptide 1 Phosphatidylinositol 4 5 bisphosphate 3 kinase 110 kDa catalytic subunit alpha Phosphatidylinositol 4 5 bisphosphate 3 kinase catalytic subunit alpha isoform Phosphoinositide 3 kinase catalytic alpha polypeptide Phosphoinositide 3 kinase regulatory subunit 1 Phosphoinositide 3 kinase regulatory subunit 1 (alpha) PI3 kinase p110 subunit alpha PI3 kinase regulatory subunit alpha PI3 kinase subunit alpha PI3 kinase subunit p85 alpha PI3K PI3K alpha PI3K regulatory subunit alpha PIK3CA PIK3R1 PtdIns 3 kinase p110 PtdIns 3 kinase regulatory subunit alpha PtdIns 3 kinase regulatory subunit p85 alpha PtdIns 3 kinase subunit alpha PtdIns 3 kinase subunit p110 alpha |
Description | Recombinant Human PI 3 Kinase p110 alpha + PI 3 kinase p85 alpha (mutated N345 K) Protein was expressed in Baculovirus infected Sf9 cells. It is a Full length protein |
Source | Baculovirus infected Sf9 cells |
AA Sequence | MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARP EEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPG SSKTEADVEQQALTLPDLAEQFAPPDIAPPLLIKLVEAIEKKGLECSTLY RTQSSSNLAELRQLLDCDTPSVDLEMIDVHVLADAFKRYLLDLPNPVIPA AVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKL SQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNE RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDT ADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSS VVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLH EYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQT QERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLK KQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRE SSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQH TSLVQHNDSLNVTLAYPVYAQQRR |
Molecular Weight | 86 kDa including tags |
Purity | >80% Densitometry. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The specific activity of this protein was determined to be 18 nmol/min/mg. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |