Recombinant Human PHO1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-6946P
Recombinant Human PHO1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-6946P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P31941-1 |
Synonym | A3A ABC3A_HUMAN APOBEC3A Apolipoprotein B mRNA editing enzyme Apolipoprotein B mRNA editing enzyme, catalytic polypeptide like 3A ARP3 bK150C2.1 Catalytic polypeptide like 3A Phorbolin 1 Phorbolin-1 PHRBN Probable DNA dC >dU editing enzyme APOBEC-3A Probable DNA dC->dU-editing enzyme APOBEC-3A |
Description | Recombinant Human PHO1 Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQ HRGFLHNQAKNLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSP CFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQV SIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGN |
Molecular Weight | 39 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |