Recombinant Human PHO1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-6946P
Recombinant Human PHO1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-6946P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P31941-1 |
Synonym | A3A ABC3A_HUMAN APOBEC3A Apolipoprotein B mRNA editing enzyme Apolipoprotein B mRNA editing enzyme, catalytic polypeptide like 3A ARP3 bK150C2.1 Catalytic polypeptide like 3A Phorbolin 1 Phorbolin-1 PHRBN Probable DNA dC >dU editing enzyme APOBEC-3A Probable DNA dC->dU-editing enzyme APOBEC-3A |
Description | Recombinant Human PHO1 Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQ HRGFLHNQAKNLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSP CFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQV SIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGN |
Molecular Weight | 39 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |