Recombinant Human Phafin-2 Protein
Beta LifeScience
SKU/CAT #: BLA-6925P
Recombinant Human Phafin-2 Protein
Beta LifeScience
SKU/CAT #: BLA-6925P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | NP_078889 |
Synonym | 110070J07Rik AA673237 FLJ13187 PH and FYVE domain containing protein 2 PH and FYVE domain-containing protein 2 PH domain containing family F member 2 PH domain-containing family F member 2 Phafin 2 Phafin-2 PHAFIN2 PKHF2_HUMAN pleckstrin homology domain containing, family F (with FYVE domain) member 2 pleckstrin homology domain containing, family F (with FYVE domain) member2 Pleckstrin homology domain-containing family F member 2 Plekhf2 ZFYVE18 Zinc finger FYVE domain containing protein 18 Zinc finger FYVE domain-containing protein 18 |
Description | Recombinant Human Phafin-2 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMVDRLANSEANTRRISIVENCFGAAGQ PLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQKKKYNKQ HIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKSEWMNHIN KCVTDLLSKSGKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRK CGFVVCGPCSEKRFLLPSQSSKPVRICDFCYDLLSAGDMATCQPARSDSY SQSLKSPLNDMSDDDDDDDSSD |
Molecular Weight | 28 kDa |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |