Recombinant Human PFAS Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-6878P
Recombinant Human PFAS Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-6878P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | O15067 |
Synonym | PFAS FGAM synthase FGAMS FGAR amidotransferase FGARAT Formylglycinamide ribotide amidotransferase Formylglycinamide ribotide synthetase KIAA0361 Phosphoribosylformylglycinamidine synthase PURL |
Description | Recombinant Human PFAS Protein (Tagged) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | RVAILREEGSNGDREMADAFHLAGFEVWDVTMQDLCSGAIGLDTFRGVAF VGGFSYADVLGSAKGWAAAVTFHPRAGAELRRFRKRPDTFSLGVCNGCQL LALLGWVGGDPNEDAAEMGPDSQPARPGLLLRHNLSGRYESRWASVRVGP GPALMLRGMEGAVLPVWSAHGEGYVAFSSPELQAQIEARGLAPLHWADDD GNPTEQYPLNPNGSPGGVAGICSCDGRHLAVMPHPERAV |
Molecular Weight | 45 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |