Recombinant Human PFAS Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-6878P
Recombinant Human PFAS Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-6878P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O15067 |
Synonym | PFAS FGAM synthase FGAMS FGAR amidotransferase FGARAT Formylglycinamide ribotide amidotransferase Formylglycinamide ribotide synthetase KIAA0361 Phosphoribosylformylglycinamidine synthase PURL |
Description | Recombinant Human PFAS Protein (Tagged) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | RVAILREEGSNGDREMADAFHLAGFEVWDVTMQDLCSGAIGLDTFRGVAF VGGFSYADVLGSAKGWAAAVTFHPRAGAELRRFRKRPDTFSLGVCNGCQL LALLGWVGGDPNEDAAEMGPDSQPARPGLLLRHNLSGRYESRWASVRVGP GPALMLRGMEGAVLPVWSAHGEGYVAFSSPELQAQIEARGLAPLHWADDD GNPTEQYPLNPNGSPGGVAGICSCDGRHLAVMPHPERAV |
Molecular Weight | 45 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Phosphoribosylformylglycinamidine synthase involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. |
Subcellular Location | Cytoplasm. |
Protein Families | FGAMS family |
Database References |