Recombinant Human Peroxiredoxin 2/PRP Protein

Name: Recombinant Human Peroxiredoxin 2/PRP Protein
Brand: Beta LifeScience
SKU: BLA-6859P
Availability: InStock

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P32119
Synonym	Epididymis secretory sperm binding protein Li 2a HEL S 2a MGC4104 Natural killer cell enhancing factor B Natural killer cell-enhancing factor B Natural Killer Enhancing Factor B NKEF B NKEF-B NKEFB Peroxiredoxin 2 Peroxiredoxin-2 PRDX 2 PRDX2 PRDX2_HUMAN PrP PRX2 PRXII PTX1 TDPX1 Thiol Specific Antioxidant 1 Thiol specific antioxidant protein Thiol-specific antioxidant protein Thioredoxin Dependent Peroxide Reductase 1 Thioredoxin peroxidase 1 Thioredoxin-dependent peroxide reductase 1 Torin TPX1 TSA
Description	Recombinant Human Peroxiredoxin 2/PRP Protein was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFV CPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLN IPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGR SVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Molecular Weight	22 kDa
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	Specific activity: approximately 200-230 pmole/min/µg. Enzymatic activity was confirmed by measuring the remaining peroxide after incubation of PRDX2 and peroxide for 20 min at room temperature. Specific activity is defined as the amount of hydroperoxide that 1 µg of enzyme can reduce at 25°C for 1 minute.
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).
Subcellular Location	Cytoplasm.
Protein Families	Peroxiredoxin family, AhpC/Prx1 subfamily
Database References	HGNC: 9353 OMIM: 600538 KEGG: hsa:7001 STRING: 9606.ENSP00000301522 UniGene: Hs.432121

Gene Functions References

Changes in PRDX2 redox/oligomeric states correlated with Obstructive Sleep Apnea severity/metabolic status. Six month of positive airway pressure (PAP) treatment decreased this overoxidation and generated multimeric overoxidized forms associated with chaperone/transduction signaling activity of PRDX2. PMID: 27864139
our data suggest that overexpression of peroxiredoxin-2, annexin A2, and heat shock protein beta-1 was correlated with tumor invasion, metastasis, and poor prognosis, and therefore, these proteins may serve as potential diagnostic and therapeutic biomarkers. PMID: 29332450
PRX-2 gene can inhibit the phenotypic change of Epidermal Stem Cells differentiating into Sweat Gland Cells and improve the ability to maintain their own specific antigens. PMID: 30070795
Prx II exhibited more effective molecular chaperone activity than Prx I when UCH-L1 was the client. Prx II interacted with UCH-L1 through its C-terminal region to protect UCH-L1 from thermal or oxidative inactivation PMID: 29339092
The c-Myc/miR-200b/PRDX2 loop regulates colorectal cancer (CRC) progression and its disruption enhances tumor metastasis and chemotherapeutic resistance in CRC. PMID: 29258530
Lys191 residue in this exposed C-terminal region of oxidized Prx2 is polyubiquitinated and the ubiquitinated Prx2 is readily degraded in proteasome and autophagy. PMID: 27703196
Our findings indicate that Prdx2 might have an important role in the regulation of trophoblast proliferation and apoptosis during early pregnancy, and that its expression is mediated by c-Myc. Thus, these two proteins may be involved in the pathogenesis of RM and may represent potential therapeutic targets PMID: 28661480
Data indicate that Prx2 is denitrosylated by Srxn1-mediated, and the two proteins physically bind via disulfide bond formation, providing a structural basis for the enzymatic reaction that requires ATP hydrolysis. PMID: 27821734
Overexpression of peroxiredoxin 2 and VEGFR2 in pterygium might be involved in the pathogenesis or recurrence of pterygium. The increase of VEGFR2 might be related to the increase of peroxiredoxin 2 in response to excessive reactive oxygen species from ultraviolet exposure. PMID: 28489720
Knockdown of peroxiredoxin 2 (Prdx2) reduced the self-renewal and sphere formation in colon cancer stem cells (CSCs). PMID: 27894099
PRDX2 and p-AKT protein expression were analyzed by immunohistochemistry technology. PMID: 28432271
Association and oligomerization of Prx II could take part in recovery and protection of the CK BB enzyme activity from inactivation during heat-induced stress. PMID: 29227081
Prx II plays a key role in the cancer stem cell self-renewal of hepatocellular carcinoma cells through redox regulation. PMID: 26866938
Peroxiredoxin-2 (PRDX2) and hemoglobin-subunits proteins, which are closely involved in the response to oxidative stress. PMID: 27869326
High PRDX2 expression is associated with colorectal cancer progression. PMID: 28125800
Knockdown of forkhead Box M1 (FoxM1) reduced Prx II levels in H-ras(G12V)-hepatocellular carcinoma (HCC) cells, indicating FoxM1 as a direct transcription factor of Prx II in HCC. PMID: 26500057
Prx1 and Prx2 are likely targets of urate hydroperoxide in cells. Oxidation of Prxs by urate hydroperoxide might affect cell function and be partially responsible for the pro-oxidant and pro-inflammatory effects of uric acid. PMID: 28348082
Data indicate that peroxiredoxin 2 (PRDX2) was upregulated in white matter multiple sclerosis (MS) lesions mainly in astrocytes, and its expression level was positively correlated with the degree of inflammation and oxidative stress, and suggest that PRDX2 expression contributes to the resistance of astrocytes against oxidative damage. PMID: 28375164
The levels of expression of carbonic anhydrase 2, catalase, and PRDX2 in the nipple discharge were significantly increased in breast ductal carcinoma patients as compared to controls. PMID: 26970563
Activation of PRX1 and -2 indicate cold atmospheric plasma affects redox homeostasis in osteosarcoma cells PMID: 28314261
ig-h3, Peroxiredoxin-2, and NRF2 have roles in cervical carcinogenesis PMID: 28261610
Data show that peroxiredoxins PRDX1 and PRDX2 are upregulated in tumor B cells as compared with normal counterparts. PMID: 26636537
Data show the protein partners of human Prx1 and Prx2 and identified three sequence motifs, or combination thereof in Prxs partners, namely: CXXC, PXXP, and LXXLL. that can be important for protein localization, function and biological pathways. [review] PMID: 26548861
Oxidative stress promotes PRX2 and PRX3 hyperoxidation and attenuates pro-survival signaling in aging chondrocytes. PMID: 26797130
Prx2 glutathionylation is a favorable reaction that can occur in cells under oxidative stress and may have a role in redox signaling. GSH/Grx1 provide an alternative mechanism to thioredoxin and thioredoxin reductase for Prx2 recycling. PMID: 26601956
the species with one disulfide and one hyperoxidized active site was decameric for Prx2 and dimeric for Prx3. Reduction and re-oxidation of the hyperoxidized dimer of Prx3 produced hyperoxidized monomers PMID: 26614766
Functional roles of catalase, PRDX2 and GPX1 during oxidative stress in human erythrocytes. PMID: 25786472
Further conclusion showed that Prdx2 regulates VM formation by targeting VEGFR2 activation, which now represents as a therapeutic target for RC. PMID: 25471788
Prx II has an important role in cancer cell survival via the modulation of signaling molecules involved in apoptosis and the phosphorylation of JNK by the downregulation of reactive oxygen species levels in A549/GR cells. PMID: 26021759
Reported increased expression of ALDH3A1, PDIA3, and PRDX2 in pterygia using a proteomic approach. These proteins are presumed to have a protective role against oxidative stress-induced apoptosis. PMID: 25221425
Prx-2 activity is compromised during red blood cell storage. PMID: 25264713
two placental proteins, Prx3 and Prx4, may act as new placental immune targets. PMID: 25323516
the main role of Prx2 in human erythrocytes is not to eliminate peroxide substrates. PMID: 24952139
Our work is the first to show that nuclear levels of PRDX2 display circadian oscillation participating in the regulation of human keratinocytes redox balance. PMID: 24814289
Taken together, cloned porcine kidney is more susceptible in JNK-induced apoptosis caused by PrxII phosphorylation, in oxidative stress condition PMID: 24909612
the reduced expression of iNOS or peroxiredoxin 2 may play an important role in the carcinogenesis of gastric cancer PMID: 24750185
Results suggest that PRDX2 may perform an important function in the pathogeneis of RCMD. PMID: 24862795
findings suggest a model in which the release of PRDX2 and TRX from macrophages can modify the redox status of cell surface receptors and enable induction of inflammatory responses PMID: 25097261
In this work we characterize Prx2 tyrosine nitration, a post-translational modification on a noncatalytic residue that increases its peroxidase activity and its resistance to overoxidation. PMID: 24719319
Prdx2 has an essential role in regulating oxidation-induced apoptosis in colorectal cancer cells. PMID: 24234423
Impaired antioxidant activity of Prx2 could contribute to the hemolysis. PMID: 24636884
These findings suggest that the transduced PEP-1-PRX2 has neuroprotective functions against oxidative stress-induced cell death in vitro and in vivo PMID: 24631653
It documents that the antioxidant protein peroxiredoxin-2 (PRDX2), the third most abundant cytoplasmic protein in RBCs, interacts with the cytoplasmic domain of B3. PMID: 23123411
Proteomic data suggest a limited protein set is involved in SET- (template activating factor-I-) mediated cytotoxicity of TCE (trichloroethylene) in hepatocytes; this set includes CFL1 (cofilin 1), PRDX2 (peroxiredoxin 2), and S100-A11 (calgizzarin). PMID: 24631019
cellular distribution of Peroxiredoxin I and II in human eyes PMID: 24152995
Up-regulation of peroxiredoxin-2 is associated with gemcitabine resistance in pancreatic cancer. PMID: 24222118
Data show peroxiredoxin 2 (Prx2) oxidation was detected at erythrocyte:neutrophil ratios found in blood and reversed over time as the oxidative burst subsided. PMID: 23603832
Data indicate that engineered Prx2 and Prx3 variants C-terminal residues modulate the extent of hyperoxidation. PMID: 24003226
our findings reveal that Prx2 is a key regulator of invasion and metastasis in melanoma PMID: 23749642
Hyperoxidized peroxiredoxin 2 interacts with the protein disulfide- isomerase ERp46. PMID: 23713588

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.