Recombinant Human Peroxiredoxin 2/PRP Protein
Beta LifeScience
SKU/CAT #: BLA-6859P
Recombinant Human Peroxiredoxin 2/PRP Protein
Beta LifeScience
SKU/CAT #: BLA-6859P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P32119 |
Synonym | Epididymis secretory sperm binding protein Li 2a HEL S 2a MGC4104 Natural killer cell enhancing factor B Natural killer cell-enhancing factor B Natural Killer Enhancing Factor B NKEF B NKEF-B NKEFB Peroxiredoxin 2 Peroxiredoxin-2 PRDX 2 PRDX2 PRDX2_HUMAN PrP PRX2 PRXII PTX1 TDPX1 Thiol Specific Antioxidant 1 Thiol specific antioxidant protein Thiol-specific antioxidant protein Thioredoxin Dependent Peroxide Reductase 1 Thioredoxin peroxidase 1 Thioredoxin-dependent peroxide reductase 1 Torin TPX1 TSA |
Description | Recombinant Human Peroxiredoxin 2/PRP Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFV CPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLN IPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGR SVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN |
Molecular Weight | 22 kDa |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Specific activity: approximately 200-230 pmole/min/µg. Enzymatic activity was confirmed by measuring the remaining peroxide after incubation of PRDX2 and peroxide for 20 min at room temperature. Specific activity is defined as the amount of hydroperoxide that 1 µg of enzyme can reduce at 25°C for 1 minute. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |