Recombinant Human Perforin Protein
Beta LifeScience
SKU/CAT #: BLA-6848P
Recombinant Human Perforin Protein
Beta LifeScience
SKU/CAT #: BLA-6848P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P14222 |
Synonym | Cytolysin FLH2 HPLH2 Lymphocyte pore-forming protein P1 PERF_HUMAN Perforin 1 perforin 1 (pore forming protein) Perforin-1 PFP PGFL PIGF PIGF-2 PLGF Pore forming protein prf1 SHGC-10760 |
Description | Recombinant Human Perforin Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | PCHTAARSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFPVDTQRFLRPDG TCTLCENALQEGTLQRLPLALTNWRAQGSGCQRHVTRAKVSSTEAVARDA ARSIRNDWKVGLDVTPKPTSNVHVSVAGSHSQAANFAAQKTHQDQYSFST DTVECRFYSFHVVHTPPLHPDFKRALGDLPHHFNASTQPAYLRLISNYGT HFIRAVELGGRISALTALRTCELALEGLTDNEVEDCLTVEAQVNIGIHGS ISAEAKACEEKKKKHKMTASFHQTYRERHSEVVGGHHTSINDLLFGIQAG PEQYSAWVNSLPGSPGLVDYTLEPLHVLLDSQDPRREALRRALSQYLTDR ARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVTF IQAWGLWGDWFTATDAYVKLFLGGQELRTSTVWDNNNPIWSVRLDFGDVL LATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRY HARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW |
Molecular Weight | 85 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Pore-forming protein that plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Plays an important role in killing other cells that are recognized as non-self by the immune system, e.g. in transplant rejection or some forms of autoimmune disease. Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes. |
Subcellular Location | Cytolytic granule. Secreted. Cell membrane; Multi-pass membrane protein. Endosome lumen. |
Protein Families | Complement C6/C7/C8/C9 family |
Database References | |
Associated Diseases | Familial hemophagocytic lymphohistiocytosis 2 (FHL2) |
Gene Functions References
- Perforin binds to membranes and undergoes substantial structural re-arrangement to form pores that enable diffusion of granzyme into the target cell [Review]. PMID: 28757431
- findings show that N-linked glycosylation of the perforin C-terminus at Asn549 within the endoplasmic reticulum inhibits oligomerisation of perforin monomers and protects the host cell from premature pore formation; studies reveal a post-translational regulatory mechanism essential for maintaining perforin in an inactive state until its secretion from the inhibitory acidic environment of the secretory granule PMID: 28808112
- Study focuses on the role of perforin in both protecting and promoting human disease. It concludes with a novel hypothesis that diversity observed in the PRF1 gene may be an example of selective advantage that protects an individual from perforin-mediated pathology, such as blood-brain barrier disruption. [review] PMID: 28757574
- Our studies suggest that although moderate levels of expression can result in partial amelioration of the hemophagocytic lymphohistiocytosis (HLH)phenotype, high levels of perforin expression per cell are required for complete correction of HLH. PMID: 27471778
- Findings support an association between childhood DNA methylation patterns in PRF1 and a record of severe respiratory syncytial virus bronchiolitis in infancy. PMID: 28253869
- our data provide the first evidence of a strict link between the absence of CD28 and the expression of perforin, which is likewise enhanced by the expression of NKG2D, within selected CD4(+) T cells from cervical cancer patients. PMID: 28087292
- A girl with neurological manifestations of familial hemophagocytic lymphohistiocytosis 2 had reduced perforin 1 expression and was found to be homozygous for a mutation in PRF1 at codon 637 in exon 3 (c.673C>T p.Arg225Trp). Her non-consanguineous parents were both heterozygous carriers of this mutation. PMID: 27271812
- Mutation in PRF1 gene is associated with hemophagocytic lymphohistiocytosis. PMID: 27781387
- Increased TIM3+CD8+T cells with lower perforin and granzyme B expression and higher CD95 expression in MDS patients were observed. PMID: 27846431
- ITP patients displayed an increased frequency of rare missense variations of the PRF1 gene PMID: 27391055
- The decreased expression of perforin in circulating CD3+CD8+ positive T cells is an important biomarker of damaged antitumor immunity in advanced lung cancer. PMID: 26586704
- Letter/Case Report: recurrent episodes of macrophage activation syndrome in peripheral spondyloarthritis with monoallelic missense mutations in PRF1. PMID: 26752080
- A new heterozygous mutation (c.916G>A and c.65delC) was identified as familial hemophagocytic lymphohistiocytosis type 2 causing defect. PMID: 26739415
- mutations result in severe chronic active Epstein-Barr virus disease PMID: 25947952
- mutations result in hemophagocytic lymphohistiocytosis PMID: 25975970
- PRF delivers granulysin and granzymes into parasite infected cells to kill the parasite. PMID: 26752517
- Among SLAMF4+ cells, the T cell fraction positive for perforin and granzyme B was higher in those obtained from healthy donors compared to SLE patients. PMID: 26314831
- elevated in the inflammatory lesions of placentas with villitis of unknown etiology PMID: 25725937
- monoallelic mutations of PRF1 decrease NK-cell cytotoxicity should be considered in individuals presenting with the manifestations of immune deficiency states that impinge on NK-cell cytotoxicity. PMID: 25776844
- Calcific aortic valve disease is characterized by increased expression of granzymes and perforin. PMID: 26897841
- linking PRF1 missense mutations to lymphoma susceptibility and highlighting clinical variability within families. PRF1 mutations should, therefore, be considered as a cause of several diseases disparate to HLH. PMID: 26184781
- identified among the key genes in circulating monocytes that were altered by exercise PMID: 26207425
- PRF1 mutations are associated with hemophagocytic lymphohistiocytosis. PMID: 26450956
- There is no association between gene polymorphisms of PRF1 gene and the susceptibility to hemophagocytic lymphohistiocytosis PMID: 26182270
- A wide heterogeneity was observed in the nature of perforin gene mutations in familial hemophagocytic lymphohistiocytosis patients in India. PMID: 25577959
- Synthetic consensus HIV-1 DNA induces potent cellular immune responses and synthesis of granzyme B, perforin in HIV infected individuals. PMID: 25531694
- analysis of the differential expression by sex of perforin in relapsed multiple sclerosis in CD4+ regulatory T cells PMID: 22837658
- The entire coding region of PRF1 was sequenced in 94 patients and 158 controls; missense variations leading to amino acid substitutions and one nonsense variation resulting in a premature stop codon found, data suggest that PRF1 variations may influence chronic inflammatory demyelinating polyradiculoneuropathy development and course PMID: 25354579
- PFN appears to form arc structures on target membranes that serve as minimally disrupting conduits for GzmB translocation. PMID: 25146929
- Perforin expression in CD4+ and CD8+ cells is a prognostic biomarker for head and neck cancer patient survival. PMID: 25344268
- Defining the interaction of perforin with calcium and the phospholipid membrane. PMID: 24070258
- findings suggest that the g.272C>T PRF1 gene single-nucleotide variation in combination with other gene alterations could increase the risk of developing nasal NK/T-cell lymphoma, at least in a subgroup of the Spanish population PMID: 24632576
- This study shows variety of clinical manifestations of perforin deficiency and although the onset of hemophagocytic lymphohistiocytosis is delayed in these patients. PMID: 24390453
- our data indicate that the co-expression of perforin and granzyme B genes exhibits anticancer potential PMID: 24696715
- miR-150 is a common post-transcriptional regulator for Prf1 in mouse and human NK cells that represses NK cell lytic activity. PMID: 24698324
- Synergistic defects of different molecules in the cytotoxic pathway lead to clinical familial hemophagocytic lymphohistiocytosis. PMID: 24916509
- PRF1 is overexpressed in systemic lupus erythematosus CD4+ T cells, but expression is not linked to the typical clinical and serological parameters associated with the disease. PMID: 24238281
- These data show that monoallelic germline mutations of PRF1 are frequent in patients with childhood anaplastic large cell lymphoma, suggesting that partially impaired cytotoxic machinery may represent a predisposing factor for it. PMID: 24309606
- Exome sequencing identified a biallelic perforin1 mutation (PRF1; p.R225W) previously associated with familial hemophagocytic lymphohistiocytosis. PMID: 23443029
- Data suggest that acidic pH microenvironment of natural killer (NK) cells enhances Cryptococcus-induced perforin degranulation suggesting that perforin degranulation is involved in the greater immunologic cytotoxic activity of NK cells in acidic pH. PMID: 23853583
- The increased percentage of CD3(-)CD56(dim) NK cells expressing perforin in patients affected by the progressive forms of MS suggests a possible role of this NK cell subpopulation in the pathogenesis of the disease. PMID: 24157130
- Perforin I polymorphism is associated with graft rejection in kidney transplant recipients. PMID: 23528102
- Missense mutations of Perforin codon His222 may lead to intrauterine presentation of familial hemophagocytic lymphohistiocytosis PMID: 23073042
- Calculated stability (free energy) changes show that the mutations mainly destabilize the protein structure, interestingly however, A91V polymorphism, leads to a more stable one. PMID: 23592409
- The mRNA and protein expression of perforin significantly increases in CD4(+) and CD8(+) T cells treated with 5-azaC, which is associated with DNA hypomethylation of perforin promoter in T cells. PMID: 17213580
- This study defines the final sequence of events controlling cytotoxic lymphocyte immune defense, in which perforin pores assemble on the target cell plasma membrane, ensuring efficient delivery of lethal granzymes. PMID: 23377437
- Chlamydia trachomatis-infected tissues have significantly higher numbers of CD3 and CD8 T cells compared to non-infected tissues (p<0.01), and that the majority of CD8+ cells do not express perforin in situ. PMID: 23216954
- FCgammaR3A and PRF1 may participate in the pathogenesis and progression of primary biliary cirrhosis. PMID: 23179144
- Distinct severity of HLH in both human and murine mutants with complete loss of cytotoxic effector PRF1, RAB27A, and STX11. PMID: 23160464
- study identified a common PRF1 haplotype in unrelated families with atypical presentation of Familial hemophagocytic lymphohistiocytosis type 2 in Colombia PMID: 22437823