Recombinant Human PDE8A Protein
Beta LifeScience
SKU/CAT #: BLA-6803P
Recombinant Human PDE8A Protein
Beta LifeScience
SKU/CAT #: BLA-6803P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O60658 |
Synonym | 5''-cyclic phosphodiesterase 8A cAMP specific cyclic nucleotide phosphodiesterase 8A FLJ16150 High affinity cAMP specific and IBMX insensitive 3'5' cyclic phosphodiesterase 8A High affinity cAMP-specific and IBMX-insensitive 3'' HsT19550 PDE 8A PDE8A PDE8A_HUMAN Phosphodiesterase 8A Phosphodiesterase8A Weakly similar to 3'5' cyclic nucleotide phosphodiesterase |
Description | Recombinant Human PDE8A Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQ VLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL |
Molecular Weight | 36 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |