Recombinant Human Parvalbumin Protein
Beta LifeScience
SKU/CAT #: BLA-6689P
Recombinant Human Parvalbumin Protein
Beta LifeScience
SKU/CAT #: BLA-6689P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P20472 |
Synonym | D22S749 MGC116759 Parvalbumin alpha PRVA_HUMAN PVALB |
Description | Recombinant Human Parvalbumin Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMSMTDLLNAEDIKKAVGAFSATDSFD HKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDAR DLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES |
Molecular Weight | 15 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |
Target Details
Target Function | In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions. |
Protein Families | Parvalbumin family |
Database References |
Gene Functions References
- These results demonstrate a specific association between elevated PVALB methylation and METH-induced psychosis. PMID: 28835159
- Our data support the hypothesis that the loss of PVALB plays a role in the pathogenesis of thyroid tumors. PMID: 27458244
- This study showed that the density of parvalbumin was significantly diminished in the basolateral complex in patients with Parkinson Disease. PMID: 28859333
- The results of this study suggested that innervation from PV-containing thalamic nuclei extends across superficial and middle layers of the human dorsolateral prefrontal cortex. PMID: 28074478
- This study demonstrated that A reduction of PV-positive cells and PV-immunoreactivity was observed exclusively in FCD type I/III specimens compared with cryptogenic tissue from control patients with a poor postsurgical outcome. PMID: 27173597
- excitatory synapse density is lower selectively on parvalbumin interneurons in schizophrenia and predicts the activity-dependent down-regulation of parvalbumin and GAD67 PMID: 27444795
- Increased numbers of PVALB neurons and fiber labeling in focal cortical dysplasia compared to nondysplastic epileptic temporal neocortex and postmortem controls may be related to cortical malformation. PMID: 26081613
- TRPV1-, TRPV2-, P2X3-, and parvalbumin-immunoreactivity neurons in the human nodose ganglion innervate the pharynx and epiglottis through the pharyngeal branch and superior laryngeal nerve PMID: 24764033
- This study demonistrated that differentially expressed in PV neurons in subjects with schizophrenia, including genes associated with WNT (wingless-type), NOTCH, and PGE2 (prostaglandin E2) signaling. PMID: 24628518
- This study showed that the parvalbumin basket cell inputs in the dorsolateral prefrontal cortex were lower in patient with schizophrenia. PMID: 24217255
- mRNA labeling at the single cell level shows a significant decrease in parvalbumin expression in Parkinson's (PD) cases; however, neuronal density of parvalbumin-positive neurons was not significantly different between PD patients and controls. PMID: 23891794
- This study demonistrated that loss of parvalbium immunoreactive axons in anterolateral columns of spinal cord in patient of lateral sclerosis spinal cords PMID: 23764361
- A subpopulation of projection neurons containing calcium-binding protein parvalbumin (PV) is identified in a precise mapping of the GABAergic cortical distribution. PMID: 23254904
- Parvalbumin neurons decrease the drive of the input to the visual cortex in contrast sensitivity. PMID: 23825418
- Data show calbindin (CB)- and tyrosine hydroxylase (TH)-cells were distributed in the three striatal territories, and the density of calretinin (CR) and parvalbumin (PV) interneurons were more abundant in the associative and sensorimotor striatum. PMID: 22272358
- PVALB is a novel diagnostic marker for Hurthle ademonas of the thyroid. PMID: 20926528
- parvalbumin has a role in calcium handling in cardiac diastolic dysfunction [review] PMID: 20093724
- In subjects with schizophrenia a reduction in parvalbumin [PV] and GAD67 mRNA expression in prefrontal cortex neurons was noted PMID: 12867516
- Slow relaxation caused by alpha-Tm mutants can be corrected by modifying calcium handling with parvalbumin. PMID: 15059934
- In dopaminergic cells of the substantia nigra in Parkinson disease an increased parvalbumin content is detected reflecting a natural protective mechanism against putative increase of intracellular calcium caused by excitotoxic injury and oxidative stress. PMID: 15257133
- demonstration of a reduced number of parvalbumin-immunoreactive projection neurons in the mammillary bodies in schizophrenia PMID: 17405923
- There is no correlation between total neuronal loss and PV-ir neuronal loss in any of the hippocampal fields in epileptic patient. PMID: 17850980
- The results of this study indicate a significant reduction in the number of PV interneurons within layer 2 of the multiple sclerosis primary motor cortex PMID: 18297277
- sequencing of PVALB was performed in 132 cases of Gitelman's syndrome in whom only one or no (N = 79) mutant SLC12A3 allele was found PMID: 18469313