Recombinant Human Parvalbumin Protein

Beta LifeScience SKU/CAT #: BLA-6689P

Recombinant Human Parvalbumin Protein

Beta LifeScience SKU/CAT #: BLA-6689P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession P20472
Synonym D22S749 MGC116759 Parvalbumin alpha PRVA_HUMAN PVALB
Description Recombinant Human Parvalbumin Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSHMSMTDLLNAEDIKKAVGAFSATDSFD HKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDAR DLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Molecular Weight 15 kDa including tags
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle.

Target Details

Target Function In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions.
Protein Families Parvalbumin family
Database References

Gene Functions References

  1. These results demonstrate a specific association between elevated PVALB methylation and METH-induced psychosis. PMID: 28835159
  2. Our data support the hypothesis that the loss of PVALB plays a role in the pathogenesis of thyroid tumors. PMID: 27458244
  3. This study showed that the density of parvalbumin was significantly diminished in the basolateral complex in patients with Parkinson Disease. PMID: 28859333
  4. The results of this study suggested that innervation from PV-containing thalamic nuclei extends across superficial and middle layers of the human dorsolateral prefrontal cortex. PMID: 28074478
  5. This study demonstrated that A reduction of PV-positive cells and PV-immunoreactivity was observed exclusively in FCD type I/III specimens compared with cryptogenic tissue from control patients with a poor postsurgical outcome. PMID: 27173597
  6. excitatory synapse density is lower selectively on parvalbumin interneurons in schizophrenia and predicts the activity-dependent down-regulation of parvalbumin and GAD67 PMID: 27444795
  7. Increased numbers of PVALB neurons and fiber labeling in focal cortical dysplasia compared to nondysplastic epileptic temporal neocortex and postmortem controls may be related to cortical malformation. PMID: 26081613
  8. TRPV1-, TRPV2-, P2X3-, and parvalbumin-immunoreactivity neurons in the human nodose ganglion innervate the pharynx and epiglottis through the pharyngeal branch and superior laryngeal nerve PMID: 24764033
  9. This study demonistrated that differentially expressed in PV neurons in subjects with schizophrenia, including genes associated with WNT (wingless-type), NOTCH, and PGE2 (prostaglandin E2) signaling. PMID: 24628518
  10. This study showed that the parvalbumin basket cell inputs in the dorsolateral prefrontal cortex were lower in patient with schizophrenia. PMID: 24217255
  11. mRNA labeling at the single cell level shows a significant decrease in parvalbumin expression in Parkinson's (PD) cases; however, neuronal density of parvalbumin-positive neurons was not significantly different between PD patients and controls. PMID: 23891794
  12. This study demonistrated that loss of parvalbium immunoreactive axons in anterolateral columns of spinal cord in patient of lateral sclerosis spinal cords PMID: 23764361
  13. A subpopulation of projection neurons containing calcium-binding protein parvalbumin (PV) is identified in a precise mapping of the GABAergic cortical distribution. PMID: 23254904
  14. Parvalbumin neurons decrease the drive of the input to the visual cortex in contrast sensitivity. PMID: 23825418
  15. Data show calbindin (CB)- and tyrosine hydroxylase (TH)-cells were distributed in the three striatal territories, and the density of calretinin (CR) and parvalbumin (PV) interneurons were more abundant in the associative and sensorimotor striatum. PMID: 22272358
  16. PVALB is a novel diagnostic marker for Hurthle ademonas of the thyroid. PMID: 20926528
  17. parvalbumin has a role in calcium handling in cardiac diastolic dysfunction [review] PMID: 20093724
  18. In subjects with schizophrenia a reduction in parvalbumin [PV] and GAD67 mRNA expression in prefrontal cortex neurons was noted PMID: 12867516
  19. Slow relaxation caused by alpha-Tm mutants can be corrected by modifying calcium handling with parvalbumin. PMID: 15059934
  20. In dopaminergic cells of the substantia nigra in Parkinson disease an increased parvalbumin content is detected reflecting a natural protective mechanism against putative increase of intracellular calcium caused by excitotoxic injury and oxidative stress. PMID: 15257133
  21. demonstration of a reduced number of parvalbumin-immunoreactive projection neurons in the mammillary bodies in schizophrenia PMID: 17405923
  22. There is no correlation between total neuronal loss and PV-ir neuronal loss in any of the hippocampal fields in epileptic patient. PMID: 17850980
  23. The results of this study indicate a significant reduction in the number of PV interneurons within layer 2 of the multiple sclerosis primary motor cortex PMID: 18297277
  24. sequencing of PVALB was performed in 132 cases of Gitelman's syndrome in whom only one or no (N = 79) mutant SLC12A3 allele was found PMID: 18469313

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

More from Other Recombinant Proteins
Greater than 90% as determined by SDS-PAGE.
Recombinant Juniperus Ashei Pectate Lyase 1
  • Molecule: Pectate Lyase 1;
  • Species: Juniperus ashei ;
  • Expression system: Yeast;
  • Tag: Tag-Free;
  • Sequence: Full Length Protein;
CAT#: BLC-02231P

Online Inquiry
Greater than 90% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Acyl-Coa-Binding Protein (ACB1) Protein (His)
  • Molecule: ACB1;
  • Species: Yeast;
  • Expression system: Yeast;
  • Tag: His;
  • Sequence: Full Length Protein;
CAT#: BLC-08185P

Online Inquiry
Greater than 90% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 μg/ml can bind human PEX19, the EC 50 of human PEX19 is 22.96-33.00 μg/ml.
Recombinant Human Atp-Binding Cassette Sub-Family D Member 1 (ABCD1) Protein (His), Active
  • Molecule: ABCD1;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: His;
  • Sequence: Full Length Protein;
CAT#: BLC-05645P

Online Inquiry
Greater than 85% as determined by SDS-PAGE.
Recombinant Acinetobacter Baumannii Efflux Pump Membrane Transporter (HMPREF0010_00594) Protein (His)
  • Molecule: HMPREF0010_00594;
  • Species: Acinetobacter baumannii ;
  • Expression system: E.coli;
  • Tag: His;
  • Sequence: Full Length Protein;
CAT#: BLC-00395P

Online Inquiry
Greater than 90% as determined by SDS-PAGE.
Recombinant Ctenocephalides Felis Salivary Antigen 1 Protein (His-SUMO)
  • Molecule: Salivary Antigen 1;
  • Species: Ctenocephalides felis ;
  • Expression system: E.coli;
  • Tag: His-SUMO;
  • Sequence: Full Length Protein;
CAT#: BLC-08547P

Online Inquiry
Greater than 90% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized OMA1 at 5 μg/ml can bind human BZW2, the EC 50 of human BZM2 is 45.42-72.22 μg/ml.
Recombinant Human Metalloendopeptidase Oma1, Mitochondrial (OMA1) Protein (His-SUMO), Active
  • Molecule: OMA1;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: His-SUMO;
  • Sequence: Full Length Protein;
CAT#: BLC-05648P

Online Inquiry
Recently viewed