Recombinant Human PARP4 Protein
Beta LifeScience
SKU/CAT #: BLA-6684P
Recombinant Human PARP4 Protein
Beta LifeScience
SKU/CAT #: BLA-6684P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9UKK3 |
Synonym | 193kDa vault protein ADP ribosyltransferase (NAD+ poly (ADP ribose) polymerase) like 1 ADP ribosyltransferase like 1 ADP-ribosyltransferase diphtheria toxin-like 4 ADPRT L1 ADPRTL 1 ADPRTL1 ARTD4 H5 proline rich I alpha I related KIAA0177 Minor vault p193 protein OTTHUMP00000042288 p193 PARP 4 PARP related PARP related / IalphaI related H5 / proline rich PARPL PH 5P PH5P Poly (ADP ribose) polymerase 4 Poly (ADP ribose) polymerase family member 4 Poly (ADP ribose) synthetase Poly (ADP ribosyl) transferase like 1 Poly ADP ribose polymerase 4 Poly ADP ribose polymerase family member 4 Vault Vault 3 Vault poly (ADP ribose) polymerase Vault poly ADP ribose polymerase Vault protein 193 kDa Vault3 von Willebrand factor A domain containing 5C VPARP VWA5C |
Description | Recombinant Human PARP4 Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | EELKKQGFLLREHFTPEATQLASEQLQALLLEEVMNSSTLSQEVSDLVEM IWAEALGHLEHMLLKPVNRISLNDVSKAEGILLLVKAALKNGETAEQLQK MMTEFYRLIPHKGTMPKEVNLGLLAKKADLCQLIRDMVNVCETNLSKPNP PSLAKYRALRCKIEHVEQNTEEFLRVRKEVLQNHHSKSPVDVLQIFRVGR VNETTEFLSKLGNVRPLLHGSPVQNIVGILCRGLLLPKVVEDRGVQRTDV GNLGSGIYFSDSLSTSIKYSHPGETDGTRLLLICDVALGKCMDLHEKDFS LTEAPPGYDSVHGVSQTASVTTDFEDDEFVVYKTNQVKMKYIIKFSMPGD QIKDF |
Molecular Weight | 40 kDa |
Purity | >= 98% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Mono-ADP-ribosyltransferase that mediates mono-ADP-ribosylation of target proteins. |
Subcellular Location | Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, spindle. |
Database References | |
Tissue Specificity | Widely expressed; the highest levels are in the kidney; also detected in heart, placenta, lung, liver, skeletal muscle, spleen, leukocytes and pancreas. |
Gene Functions References
- Major vault protein is important in the drug resistance of cancer cells, but it requires the presence of vPARP for full activity PMID: 28551640
- PARP4 is a possible susceptibility gene of primary thyroid and breast cancer PMID: 26699384
- the protein levels of MVP, TEP1 and vPARP are actually increased in the highergrade tumors suggesting existence of post-transcriptional regulation of vault component production. PMID: 23739867
- REVIEW:recent findings suggesting that PARP-1 participates in DNA damage signaling in cell death PMID: 12829019