Recombinant Human Nitric Oxide Synthase, Inducible (NOS2) Protein (GST)

Name: Recombinant Human Nitric Oxide Synthase, Inducible (NOS2) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-07563P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Nitric Oxide Synthase, Inducible (NOS2) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P35228
Target Symbol	NOS2
Synonyms	(Hepatocyte NOS)(HEP-NOS)(Inducible NO synthase)(Inducible NOS)(iNOS)(NOS type II)(Peptidyl-cysteine S-nitrosylase NOS2)
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRC
Expression Range	1-200aa
Protein Length	Partial
Mol. Weight	49.2 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In macrophages, NO mediates tumoricidal and bactericidal actions. Also has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such PTGS2/COX2. As component of the iNOS-S100A8/9 transnitrosylase complex involved in the selective inflammatory stimulus-dependent S-nitrosylation of GAPDH on 'Cys-247' implicated in regulation of the GAIT complex activity and probably multiple targets including ANXA5, EZR, MSN and VIM. Involved in inflammation, enhances the synthesis of proinflammatory mediators such as IL6 and IL8.
Subcellular Location	Cytoplasm, cytosol.
Protein Families	NOS family
Database References	HGNC: 7873 OMIM: 163730 KEGG: hsa:4843 STRING: 9606.ENSP00000327251 UniGene: PMID: 30297396 the present findings were the first to show that KLF5 expression and nitration by iNOS-mediated peroxynitrite are necessary for the induction of TNF-alpha and IL-1beta expression in VSMCs of diabetic vascular tissues. PMID: 28711598 iNOS microsatellite polymorphism may contribute to the genetic background of atrial fibrillation in Chinese-Taiwanese patients. PMID: 28205526 High expression of iNOS and STAT3 in cells transfected with miR-34a mimic further validated it. PMID: 30021364 ur findings endorse polymorphic regulation of iNOS expression, altered oxidant-antioxidant components and evidences of risk association as the hallmark of malaria pathogenesis. iNOS/NO may serve as potential diagnostic marker in assessing clinical malaria. PMID: 29268202 NOS2A_ (CCTTT)n gene variations may influence inflammatory bowel disease susceptibility in the Moroccan population. PMID: 29307990 The results indicated that the expression levels of interleukin6 and inducible nitric oxide synthase (iNOS) were decreased, whereas collagen expression and deposition were increased in ketaminetreated SMCs. Conversely, treatment with CTX restored the expression of iNOS, which may prevent or limit oxidative damage PMID: 29207018 The present study demonstrated that iNOS C150T polymorphism did not show significant association with metabolic syndrome. PMID: 29637536 KLF4 activated the transcription activity of iNOS promoter in MH7A cells stimulated by TNF-alpha. This study indicates that KLF4 is important for regulating the expression of iNOS by TNF-alpha in human synoviocytes. PMID: 28744810 Coexpression of NOS2 and COX2 accelerates tumor growth and reduces survival in estrogen receptor-negative breast cancer. PMID: 29087320 NOS2 T allele of rs2297514 significantly increased the risk of a non-union during the fracture healing process by 38% compared to the C allele. Further stratification analyses conducted for this SNP using data from subgroups classified by different sites of fracture indicated that significance could only be observed in the tibial diaphysis subgroup. PMID: 29518099 NOS2 polymorphisms in prediction of benefit from first-line chemotherapy in metastatic colorectal cancer patients PMID: 29522543 PEDF protects human glomerular mesangial cells from diabetes-derived oxidative stress via NOXO1- iNOS suppression. PMID: 28944893 The studies established a potential link between leptin and adipocyte insulin responsiveness in an NOS2 dependent manner. PMID: 28739528 Collectively, our results demonstrated sanggenon C induced apoptosis of colon cancer cells by increased reactive oxygen species generation and decreased nitric oxide production, which is associated with inhibition of inducible nitric oxide synthase expression(iNOS) and activation of mitochondrial apoptosis pathway. PMID: 28849234 Data show that infecting unencapsulated E. faecalis cps2 is a stronger stimulator for toll like receptor 2 (TLR2) and interleukin-1beta (IL-1beta) mRNAs, but not for inducible nitric oxide synthase (iNOS) mRNA. PMID: 28800779 Results show that NOS2A CpG(+5099) was associated with increased FeNO and that the magnitude of association between black carbon exposure and demethylation of NOS2A CpG(+5099) measured 5 days later appeared to be greater among seroatopic children, especially those sensitized to cockroach allergens. PMID: 28588744 Results support that iNOS polymorphisms not only are associated with Henoch-Schonlein purpura (HSP) risk but also strongly contribute to the genetic basis of individual differences in the progression of HSP to nephritis among Chinese Han children. PMID: 28593405 This study investigates whether the -1026(A>C)(rs2779249) and +2087(A>G)(2297518) polymorphisms in the NOS2 gene are associated with chronic periodontitis (CP). The analysis demonstrated, after correction for multiple comparisons, that only the female gender was significantly associated with CP. PMID: 28617311 The study summarizes and discuss NOS2 expression in tumor-associated leukocytes and elucidate nitric oxide signaling during tumor initiation, tumor progression. [review] PMID: 27397579 Studies show that majority of patients with gastrointestinal cancer have elevated expression of NOS2. Furthermore, NOS/NO levels are often associated with increased metastasis, leading to poor patient prognosis. The association of elevated NOS2 expression with cancers arising due to bacterial, viral, and fungal infections suggests an important relationship of tumor immune response and chronic inflammation. [review] PMID: 27494631 Results show that overexpression of iNOS is associated with aggressive phenotype and poor survival outcome in ovarian cancer patients, and indicates that iNOS/NO play a dual role of in tumor glycolysis and progression PMID: 28380434 Positive rates of iNOS in cervical tissues were 72.1%, 28.2%, and 3.1% in the -HPV-positive patients with cervical cancer (CC group), HR-HPV group, and controls, respectively (P < 0.05). Levels of TLR3, TLR4, TLR7, TLR8, NF-kappaB p65, and iNOS in cervical epithelial cells were higher in CC group than in other groups. PMID: 28626766 Studies show that NOS2 is highly expressed in ovarian and prostate tumors and provide evidence for its role in the development of aggressive ovarian cancer and progression of prostate cancer. [review] PMID: 28326819 Studies elucidate the nitric oxide-driven pathways which implicate NOS2 as a key driver of breast cancer disease progression. [review] PMID: 27464521 Although haplotype analysis revealed that no NOS2 haplotype was associated with leprosy susceptibility/resistance with statistical significance, GTG haplotype was noted to be more frequent in healthy controls. PMID: 28315742 The results shed light on the potential relevance of NOS2 as a prognostic factor for glioma malignancy and recurrence. PMID: 28424427 These data revealed that human endogenous retrovirus W env might contribute to increase nitric oxide production and microglial migration ability in neuropsychological disorders by regulating the expression of inducible nitric oxide synthase. PMID: 28656540 Since RP11-19P22.6-001 acts in cis to regulate nitric oxide synthase 2 (NOS2), we also analyzed NOS2 expression and its correlation with gastric cancer. The combined use of lncRNAs and their target genes may be a promising method to increase the diagnostic value of lncRNAs in cancer. PMID: 28128738 expression elevated in preeclampsia placentas PMID: 27030287 Inducible nitric oxide synthase is able to regulate many cytokines in mast cells involved in the development of irritable bowel syndrome. PMID: 26940641 Role of a conserved tyrosine residue in the FMN-Heme interdomain electron transfer in inducible nitric oxide synthase. PMID: 27633182 expression highly associated with hallmarks of psoriasis such as hypogranulosis and neutrophils, but negatively associated with eosinophils and spongiosis which are characteristics of eczema PMID: 27193975 Bone marrow mesenchymal stromal cells induce the rapid differentiation of CD11b+ myeloid cells from bone marrow progenitors, and such an activity requires the expression of nitric oxide synthase-2. PMID: 28183849 Studied iNOS(inducible nitric oxide synthase) activation thru mPGES-1 (microsomal prostaglandin E synthase-1) signaling driven by EGFR (EGF receptor) in cancer progression models. PMID: 28257996 Higher expression of inducible nitric oxide synthase (NOS2) is associated with poor survival in patients with pancreatic ductal adenocarcinoma (PDAC). PMID: 27367029 The Oncogenic Properties Of The Redox Inflammatory Protein Inducible Nitric Oxide Synthase In ER(-) Breast Cancer. PMID: 28162269 Exploration into the mechanisms of the cGMP-mediated protection identified a role for the iNOS/NO/cGMP pathway in the activation of ADAM17 (TACE), which is a sheddase that cleaves a number of cell surface receptors including TNF receptor type 1 (TNFR1). PMID: 28162283 results suggest that NOS2 polymorphisms may influence the risk of aggressive prostate cancer and that these polymorphisms could have an impact on disease pathogenesis, possibly by affecting intracellular nitric oxide levels. PMID: 28162285 no significant difference in frequency of NOS2-1659C/T polymorphism was observed between patients and controls. None of the studied SNPs were associated with erosive disease, seropositivity or extra-articular manifestations. The -277A/G and -1026 G/T promoter polymorphisms in iNOS may confer susceptibility to rheumatoid arthritis (RA). in South Indian Tamils. PMID: 28374504 This is the first reported evidence for NO-enhanced bystander aggressiveness in the context of PDT. In the clinical setting, such effects could be averted through pharmacologic use of iNOS inhibitors as non-ionizing photodynamic therapy adjuvants PMID: 27884704 This increase was inhibited in the presence of the nonspecific iNOS inhibitor aminoguanidine (AG). PMID: 27247425 our study shows that the expression of iNOS is increased in both central airways and the alveolar parenchyma, but not in BAL cells, in uncontrolled asthmatics as compared to controlled asthmatics and healthy controls. PMID: 27647044 We found that lowering the glucose concentration increased expression of genes coding for inducible nitric oxide syntheas, NOS2 and NOS2A resulting in enhanced production of nitric oxide PMID: 28157664 Downregulation of inducible NO synthetase (iNOS) resulted in downregulation of heme oxygenase 1 (HO-1), and, conversely, upregulation of iNOS enhanced HO-1 activity. PMID: 27752990 expression in synovial subintima was significantly higher in early than in advanced osteoarthritis PMID: 27958655 ATM-reactive oxygen species-iNOS axis regulates nitric oxide mediated cellular senescence. PMID: 27845209 The risk of developing chronic pancreatitis is not increased by the presence of the iNOS-2087A>G polymorphism. PMID: 28125406 NOS2 rs2779248, NOS2 rs1137933, and NOS3 rs3918188 genetic polymorphisms are potentially related to the susceptibility to type 2 diabetes mellitus (T2DM), and the rs1800783 polymorphism might be considered as genetic risk factors for diabetic nephropathy. PMID: 27192959 Patients with Marfan syndrome showed elevated NOS2 and decreased ADAMTS1 protein levels in the aorta. PMID: 28067899

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.