Recombinant Human Leukocyte Surface Antigen Cd47 (CD47) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-05627P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Leukocyte Surface Antigen Cd47 (CD47) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-05627P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Leukocyte Surface Antigen Cd47 (CD47) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined by its ability to bind Human SIRPA in functional ELISA is less than 200 ng/ml. |
| Uniprotkb | Q08722 |
| Target Symbol | CD47 |
| Synonyms | Antigen identified by monoclonal 1D8; Antigenic surface determinant protein OA3; CD 47; CD47; CD47 antigen (Rh-related antigen; integrin-associated signal transducer); CD47 antigen; CD47 glycoprotein; CD47 molecule; CD47_HUMAN; IAP; Integrin Associated Protein; Integrin associated signal transducer; Integrin-associated protein; Leukocyte surface antigen CD47; MER 6; MER6; OA 3; OA3; OTTHUMP00000041152; OTTHUMP00000041153; Protein MER6; Rh related antigen; Surface antigen identified by monoclonal 1D8 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-hFc |
| Complete Sequence | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP |
| Expression Range | 19-139aa |
| Protein Length | Partial |
| Mol. Weight | 40.8 kDa |
| Research Area | Immunology |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection. |
| Subcellular Location | Cell membrane; Multi-pass membrane protein. |
| Database References | HGNC: 1682 OMIM: 601028 KEGG: hsa:961 STRING: 9606.ENSP00000355361 UniGene: PMID: 28378740 |
