Recombinant Human Interleukin-4 Receptor Subunit Alpha (IL4R) Protein (His)

Name: Recombinant Human Interleukin-4 Receptor Subunit Alpha (IL4R) Protein (His)
Brand: Beta LifeScience
SKU: BLC-00251P
Price: 240.0 USD
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Back to school. back to lab. ready for results. - advance your research with beta lifescience, Buy cytokines, chemokines, and growth factors for research online, High-purity interleukins & receptors for research, High-quality cytokines for advanced research, High-quality recombinant proteins, In-stock recombinant proteins

Price Save $204

Size

100ug

Quantity

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Interleukin-4 Receptor Subunit Alpha (IL4R) Protein (His) is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P24394
Target Symbol	IL4R
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-10His
Target Protein Sequence	GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
Expression Range	24-232aa
Protein Length	Partial
Mol. Weight	25.4 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.; Soluble IL4R (sIL4R) inhibits IL4-mediated cell proliferation and IL5 up-regulation by T-cells.
Subcellular Location	Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.
Protein Families	Type I cytokine receptor family, Type 4 subfamily
Database References	HGNC: 6015 OMIM: 147781 KEGG: hsa:3566 STRING: 9606.ENSP00000170630 UniGene: PMID: 28706306 Interleukin-4 receptor subunit alpha (IL-4Ralpha) haplotypes for Val75Ile, Ser503Pro, and Arg576Gln are associated with measles Immunoglobulin G production in Mozambican children but not Australian children. IL-4Ralpha 503Pro is more prevalent in Mozambique vaccine failure cases compared with controls. PMID: 28594599 We consider that although no association was found among diverse SNPs from human IL-10 and IL-4 promoter regions and gastric cancer event, the present research provides insight into two possible biomarkers of immunological nature (increased level of serum IL-4) and genetic nature (presence of the IL-10, -G1082A SNP) related to this neoplasm in our population. PMID: 30526523 IL4RA and ADAM33 variants may be risk markers of asthma exacerbations in type-2 inflammatory endotype. Precise endotyping may facilitate the identification of genetic risk markers of asthma exacerbations. PMID: 28326636 this study shows that the IL-4Ralpha polymorphism is associated with susceptibility to chronic immune thrombocytopenia PMID: 28511637 Here in this review, we discuss the structural details of IL-4 and IL-4Ralpha subunit and the structural similarities between IL-4 and IL-13. We also describe detailed chemistry of type-I and type-II receptor complexes and their signaling pathways. Furthermore, we elaborate the strength of type-II hetero dimer signals in response to IL-4 and IL-13. PMID: 27165851 Naive CD4+ Tconv cells from subjects with asthma bearing the IL4RR576 mutation show defective induction of iTreg cells and their skewing toward a TH17-like phenotype. PMID: 27479084 Result showed that exposure of Peripheral Blood-Mesenchymal Stem Cells (PB-MSCs) to Noggin was associated with changes in pattern of CD29/CD184 expression. The expression profile of CD29(+/-)/CD184(-) can be suggested as a robust signature for tracing differentiation of PB-MSCs into neuronal cells. PMID: 27478015 The promoter methylation levels of GATA3, IL-4, and TGF-beta were significantly higher in active VKH patients than in healthy individuals PMID: 28278322 A positive association exists between the IL-4R Q551R polymorphism and occurrence of chronic periodontitis. PMID: 28392616 Single nucleotide polymorphism of IL-4Ralpha 175 V was linked to greater Atopic dermatitis risk at 2 to 3 years of age. PMID: 27274543 IL-4Ralpha gene (I50V) polymorphism may play a role in development of eczema among Saudi children PMID: 27018548 genetic polymorphism is associated with autoimmune hepatitis in Brazilian children PMID: 26693492 IL4Rrs2107356 and IL8rs2227307 SNPs were associated with an increased risk of invasive aspergillosis. PMID: 26667837 Essential role of endocytosis for interleukin-4-receptor-mediated JAK/STAT signalling. PMID: 26306492 analysis of IL-4 and IL-13 receptors in cancer biology and discussion of pre-clinical and clinical studies pertaining to recombinant immunotoxins designed to target these receptors [review] PMID: 26088753 review of IL-4 and IL-13 receptor structure, receptor regulation, signaling and experimental therapeutics [review] PMID: 26187331 There is no correlation between the Arg551Gln polymorphism in IL-4R gene and asthma predictive index results PMID: 26695670 Studies indicate significant association between the interleukin-4receptor (IL-4R) Q576R polymorphism and the risk of asthma in the Chinese Han population. PMID: 25867440 Results illustrated that Saudi vitiligo patients showed significantly higher frequency of the IL-4R (Q551R A>G) homozygous GG variant (recessive mode) as compared with their respective controls PMID: 23774696 higher frequency of polymorphisms in patients with familial hypercholesterolemia PMID: 25110223 IL-4RA-1902 A/A genotype has been associated with a reduced response to IL-4 and has been found in 90% oral mucous membrane pemphigoid patient PMID: 23557074 Genetic variants of NOS3, CD14, MMP3 and IL4R are implicated in the determination of VEGF expression and plasma levels. PMID: 26437765 IL4R mediates enhanced glucose and glutamine metabolism in breast cancer cells. PMID: 25746764 Receptor trafficking may play an important role for the regulation of IL-4R-mediated JAK/STAT signaling. PMID: 25468331 Gene interactions were observed between IL4R and TNF-alpha genes in hand osteoarthritis patients. PMID: 25252624 Selective augmentation of IL-4Ralpha signaling in Treg cells induced their reprogramming into Th2-like cells and disease susceptibility towards food allergy. PMID: 25769611 Data show that high expression of interleukin-4 receptor IL-4Ralpha correlated with increased recurrence, while interleukin-13 receptor IL-13Ralpha1 had an inverse relationship to recurrence and survival in oral cavity squamous cell carcinoma patients. PMID: 25483786 Higher TGF-beta with lower CD124 and TSLP, but no difference in PAR-2 expression in bronchial biopsy of bronchial asthma patients in comparison with COPD patients. PMID: 24185116 Analysis of IL4R SNP haplotypes or complex alleles suggested no dominant protection in patients with Recurrent spontaneous abortion PMID: 24803421 Results suggest that the physical interaction between the cytoplasmic domains of IL-13Ralpha2 and IL-4Ralpha regulates IL-4 signaling through the IL-4Ralpha-IL-13Ralpha1 receptor complex. PMID: 24056919 increased expression in B cells of patients with house dust mites allergic asthma PMID: 24975796 The binding of [AP1-V12]6 to cancer cells was remarkably reduced when IL-4 receptors were blocked by antibody against IL-4 receptor further confirmed its binding PMID: 24339977 Increased Th17 cell frequency and poor clinical outcome in rheumatoid arthritis are associated with a genetic variant in the IL4R gene, rs1805010. PMID: 24782180 beta-defensin-2 and interleukin-4 receptor are biomarkers that improve the prediction of poor-outcome over clinical variables in the acute phase of stroke PMID: 24386991 The IL4RA I50V and Q551R polymorphisms may be risk factors for developing asthma. PMID: 23922687 This meta-analysis indicates that the I50V polymorphism of IL-4R gene may confer susceptibility to RA PMID: 23972290 the polymorphism of IL-4Ralpha rs1801275 confers individual's variable susceptibility to glioma, particularly among Asians. PMID: 23979976 Rs1805012 polymorphism of IL-4R gene is associated with asthma. PMID: 24510574 Genetic variants in IL4R were identified, and their association with the progression rate of joint damage in rheumatoid arthritis was independently replicated. PMID: 23983153 Single nucleotide polymorphisms in IL4R gene is associated with the risk of adult glioma. PMID: 23525950 The rs1801275 in IL-4R showed an increased risk of glioblastoma. PMID: 23663500 An meta-analysis suggests that the IL-4Ralpha rs1801275 polymorphism is not a genetic predictor for glioma. PMID: 23395224 reduced IL-4R signalling has stage-specific effects on colorectal carcinogenesis (increased CRC initiation and risk but reduced tumour progression and no effect on CRC mortality). PMID: 23784081 These findings support a pathogenic role for IL-4Ralpha on Th cells following respiratory syncytial virus reinfection PMID: 23543769 Reduced interleukin-4 receptor alpha expression on CD8+ T cells correlates with higher quality anti-viral immunity. PMID: 23383283 Data indicate that single nucleotide polymorphism (SNP) rs1805015 in the IL4Ralpha gene was significantly associated with eczema in the additive and dominant models. PMID: 23480403 Passive smoking causes significant rise in plasma TNFa and IL4 with a dose dependent effect PMID: 23066418 Interacting determinants of atopy, total IgE, IgE against prevalent allergens, and IL4RA polymorphisms, contribute to the high prevalence of betalactams allergy in South of Spain. PMID: 22764749 A protective association for Hodgkin lymphoma was observed on the IL4R gene with haplotype TCA PMID: 22902050

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.