Recombinant Human Granzyme B (GZMB) Protein (His)

Name: Recombinant Human Granzyme B (GZMB) Protein (His)
Brand: Beta LifeScience
SKU: BLC-09751P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Granzyme B (GZMB) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P10144
Target Symbol	GZMB
Synonyms	C11; Cathepsin G like 1; Cathepsin G-like 1; CCPI; CGL 1; CGL1; CSP B; CSPB; CTLA 1; CTLA-1; CTLA1; CTSGL1; Cytotoxic serine protease B; Cytotoxic T lymphocyte associated serine esterase 1; Cytotoxic T lymphocyte proteinase 2; Cytotoxic T-lymphocyte proteinase 2; Fragmentin 2; Fragmentin-2; GRAB_HUMAN; Granzyme 2; Granzyme B (granzyme 2; cytotoxic T lymphocyte associated serine esterase 1); Granzyme B; Granzyme-2; GranzymeB; GRB; Gzmb; Hlp; Human lymphocyte protein; Lymphocyte protease; Protease; serine; B; SECT; T cell serine protease 1 3E; T cell serine protease 1-3E; T-cell serine protease 1-3E
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
Expression Range	21-247aa
Protein Length	Full Length of Mature Protein
Mol. Weight	27.5kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent pyroptosis when delivered into the target cell through the immunological synapse. It cleaves after Asp. Once delivered into the target cell, acts by catalyzing cleavage of gasdermin-E (GSDME), releasing the pore-forming moiety of GSDME, thereby triggering pyroptosis and target cell death. Seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis.
Subcellular Location	Secreted. Cytolytic granule.
Protein Families	Peptidase S1 family, Granzyme subfamily
Database References	HGNC: 4709 OMIM: 123910 KEGG: hsa:3002 STRING: 9606.ENSP00000216341 UniGene: PMID: 29319368 Serum interleukin 1 receptor antagonist (IL1RA) and granzyme B (GZMB) levels were markedly increased in Crohn's disease (CD) patients, suggesting that these markers can serve as biomarkers to identify gut inflammation. PMID: 28972805 Authors found that R(48)-GzmB is a stable protein that accumulates to similar levels in activated NK cells as Q(48)-GzmB. rs8192917 polymorphism may influence antitumor activity and the effect of antitumor cellular immunotherapy. PMID: 28653095 GzmA and gzmB were predominantly expressed by natural killer cells, and during abdominal sepsis, the percentage of these cells expressing gzms in peritoneal lavage fluid decreased, while the amount of expression in the gzm(+) cells increased PMID: 28694562 Study provides evidence that Il10 expression is limited to migratory CD25++ regulatory T cells only. PMID: 27756896 Long-term lung function decline in asthma is associated with elevation of bronchial CD8 and CD4 at baseline, and CD8, CD3 and granzyme B at follow-up PMID: 27230446 Granzyme B breaches the inner membrane through Tim22, the metabolite carrier translocase pore, in a mitochondrial heat-shock protein 70-dependent manner. PMID: 28338658 Differential proteomics were used to identify granzyme B substrates in three unrelated bacteria: Escherichia coli, Listeria monocytogenes, and Mycobacteria tuberculosis. Granzyme B cleaves a highly conserved set of proteins in all three bacteria, which function in vital biosynthetic and metabolic pathways that are critical for bacterial survival under diverse environmental conditions. PMID: 29107333 Proteolysis by granzyme B enhances presentation of autoantigenic PAD4 epitopes in rheumatoid arthritis. PMID: 27700100 our results suggest granzyme B PET imaging can serve as a quantitatively useful predictive biomarker for efficacious responses to cancer immunotherapy. PMID: 28461564 Plasma GzmB levels may reflect the degree of pruritus and dermatitis in patients with atopic dermatitis PMID: 27686401 These results suggest the critical importance of miR-378 in the regulation of GrzB expression and a protective role for GrzB in controlling dengue virus replication in vivo. PMID: 26166761 Analysis of infiltrating granzyme B-expressing T cells at the invasive borders of the colon tumors revealed a significant difference in expression granzyme by race underlining decreased antitumor cytotoxic immunity in African Americans. PMID: 27310868 Increased TIM3+CD8+T cells with lower perforin and granzyme B expression and higher CD95 expression in MDS patients were observed. PMID: 27846431 granzyme-B levels were found to be significantly associated with increased insulin resistance in adolescent polycystic ovary syndrome patients. Additionally, elevated levels of serum granzyme-B were predictive for increased cardiovascular risk in PCOS patients PMID: 26802256 results suggest that enhanced IL-21R expression of CD19(+)CD5(+) B cells and production of IL-21 by iNKT cells may play an important role in the pathogenesis of pSS by regulating CD19(+)CD5(+) B cell functions and increasing GrB production, presumably leading to a counter-regulatory effect in the disease. PMID: 26884645 Findings show that GrB was produced in 57.1% colorectal cancer cell (CRC) lines and 100% CRC-derived Cancer Stem Cells and present a novel role for GrB as up-modulator of epitelial-to-mesenchimal transition in CRC cells. PMID: 26830472 FASL, granzyme B, and cytochrome c blood expression reflects breast cancer progression and response to therapy. (Review) PMID: 27117663 Data show that NK cell lines could secreted rapidly inactive Mr 35 000 granzyme B (GZB)outside secretory lysosomes (SLs). PMID: 26927382 Data suggest that reactive oxygen species (ROS) generated within cytotoxic lymphocytes by receptor stimulation are required for lysosomal permeabilization and release of GzmB (granzyme B) into the cytosol and for inactivation of serpin B9. PMID: 26670609 these results suggest a perforin-independent, extracellular role for GzmB in the pathogenesis of cardiac fibrosis PMID: 26610869 Among SLAMF4+ cells, the T cell fraction positive for perforin and granzyme B was higher in those obtained from healthy donors, while the percentage of T cells that were single-positive for granzyme B was higher in cells obtained from patients with SLE. PMID: 26314831 Costimulation blockade by abatacept can decrease the serum levels of GZMB in rheumatoid arthritis patients responding to the treatment. PMID: 26633185 elevated in the inflammatory lesions of placentas with villitis of unknown etiology PMID: 25725937 Combined evaluation of granzyme B and perforin may have a role in noninvasive diagnosis of acute rejection after kidney transplantation. PMID: 25643139 this study emphasizes that the coordinated action of hGzmB-activated p53 and GzmB-cleaved Bid is important for GzmB-induced cell death and for cytotoxic lymphocyte/Natural Killer Cell-mediated killing of target cells. PMID: 25404359 identified among the key genes in circulating monocytes that were altered by exercise PMID: 26207425 GB-induced ROS significantly promote apoptosis. PMID: 25361078 Active secretion of CXCL10 and CCL5 from colorectal cancer microenvironments associates with granzymeB+ CD8+ T-cell infiltration. PMID: 25671296 Synthetic consensus HIV-1 DNA induces potent cellular immune responses and synthesis of granzyme B, perforin in HIV infected individuals. PMID: 25531694 GzmB plays no role in the pathogenesis of keloids and hypertrophic scars. PMID: 26410968 PFN appears to form arc structures on target membranes that serve as minimally disrupting conduits for GzmB translocation. PMID: 25146929 These results suggest that GZMB Q55R, P94A, and Y247H polymorphisms are not significantly associated with colon cancer incidence, or metastasis to lymph node and distant organ. PMID: 25313744 CD4+ T cell-derived IL-21 and deprivation of CD40 signaling favor the in vivo development of granzyme B-expressing regulatory B cells in HIV patients. PMID: 25780036 Data indicate that treatment with toll-like receptor 8 (TLR8) agonists elicited granzyme B production. PMID: 25667415 The results of study found implicate possible effect of this genetic polymorphism in susceptibility to SSPE which needs to be confirmed in bigger populations. PMID: 24875585 Activated CD4 and CD8 T cells secrete similar amounts of GrzB. PMID: 25245659 The suppression-abrogating cytokine IL-6 augments GzmB expression by human CD4 T cells, and it inhibits Treg suppression via a nonapoptotic GzmB-mediated mechanism. PMID: 25637022 Polarized granzyme release is required for antigen-driven transendothelial migration of human effector memory CD4 T cells. PMID: 25367116 CASP is specifically cleaved by granzymeB. PMID: 25159843 Serum concentrations of granzyme B in patients with ovarian cancer were substantially increased in comparison to concentrations in patients with ovarian cystadenomas or ovarian teratomas. PMID: 24673566 The GrB-Sb9 nexus may therefore represent an additional mechanism of limiting lymphocyte lifespan and populations. PMID: 24488096 our data indicate that the co-expression of perforin and granzyme B genes exhibits anticancer potential PMID: 24696715 Cancer cells released soluble factors that inhibited granzyme B, perforin and IFN-gamma production. PMID: 24894428 multiple linear regression analysis revealed that both type 2 diabetes mellitus and central obesity were predicting factors for GzmB, findings reveal a possible role of GzmB in type 2 diabetes mellitus. PMID: 24195710 cleaves proIL-18 into active form and promotes apoptosis in the inflammed skin PMID: 23820889 These results suggest that GrzB from CCR5+ memory CD4 T cells may have a role in cellular and tissue pathologies during HIV infection. PMID: 24999042 These data indicate that IBD-related inflammation is marked by mucosal accumulation of cytotoxic, GrB-expressing CD19(+) and IgA(+) cells, suggesting a role for these cells in IBD-associated epithelial damage. PMID: 24835396 Report increased granzyme B expression in discoid lupus erythematosus. PMID: 23980805 Unlike IL-18 and FKN, plasma GZB may have a role in severity of acute coronary syndrome PMID: 24307760

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.