Recombinant Human Golgi Membrane Protein 1 (GOLM1) Protein (GST)

Name: Recombinant Human Golgi Membrane Protein 1 (GOLM1) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-08328P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Golgi Membrane Protein 1 (GOLM1) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q8NBJ4
Target Symbol	GOLM1
Synonyms	bA379P1.3; C9orf155; Chromosome 9 open reading frame 155; Golgi membrane protein 1; Golgi membrane protein GP73; Golgi phosphoprotein 2; Golgi protein 73 kD ; Golgi protein 73kD ; GOLM 1; GOLM1; GOLM1_HUMAN; GOLPH 2; GOLPH2; GP 73; GP73; PSEC0257
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Expression Range	36-401aa
Protein Length	Partial
Mol. Weight	68.6kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Unknown. Cellular response protein to viral infection.
Subcellular Location	Golgi apparatus, cis-Golgi network membrane; Single-pass type II membrane protein. Note=Early Golgi. Cycles via the cell surface and endosomes upon lumenal pH disruption.
Protein Families	GOLM1/CASC4 family
Database References	HGNC: 15451 OMIM: 606804 KEGG: hsa:51280 STRING: 9606.ENSP00000373363 UniGene: PMID: 29181846 Results showed that GOLM1 was significantly upregulated in both LUAD and LUSC tissues compared to the normal controls. However, GOLM1 expression was higher in LUAD tissues than in LUSC tissues. PMID: 29843532 GOLM1 was highly expressed in lung adenocarcinoma cells and associated with low survival ratio and higher grade malignancy; overexpression of GOLM1 promoted the cell proliferation. PMID: 29710483 PDGFA/PDGFRalpha-regulated GOLM1 promotes glioma progression possibly through activation of a key signaling kinase, AKT PMID: 29282077 GP73 is an effective and reliable serological marker for the diagnosis of advanced fibrosis and prediction of appearance of cirrhosis PMID: 29256057 GOLPH2 promotes the progression of pancreatic ductal adenocarcinoma. PMID: 29344673 serum GP73 is an accurate serum marker for significant fibrosis in chronic HBV infection, with higher accuracy than APRI and FIB-4. Serum GP73 is potentially a complementary tool for TE when evaluating the necessity of antiviral treatment, particularly in patients without definite antiviral indication. PMID: 29082644 The detection of ALT, AFP, AFP-L3, and GP73 has a certain guiding significance to predict the risk of hepatocellular carcinoma in hepatic cirrhosis patients PMID: 28540298 The mechanism of hepatocarcinogenesis and a promising blueprint for miR-493-5p-GP73 axis-oriented treatment of HCC. PMID: 28419971 GP73 unglycosylation is associated with hepatocellular carcinoma cell motility and invasiveness. PMID: 26993603 The GOLPH2 is a novel marker for non-small-cell lung cancer. PMID: 28880107 Findings suggest that GP73 silencing through siRNA delivery may provide a low-toxicity therapy for the inhibition of tumor proliferation and metastasis. PMID: 26870893 Both gain- and loss-of-function studies determine that GOLM1 acts as a key oncogene by promoting HCC growth and metastasis. PMID: 27569582 A cytokine QTL at the NAA35-GOLM1 locus markedly modulated interleukin (IL)-6 production in response to multiple pathogens and was associated with susceptibility to candidemia. PMID: 27376574 knock-down of GP73 down-regulates HCV infection and replication in Huh7-MAVSR cells and primary human hepatocytes PMID: 28394926 Studies indicate that golgi membrane protein 1 (GOLM1) may promote HCC by regulation of epidermal growth factor receptor (EGFR) recycling, and suggest that therapeutic targeting of GOLM1 may be a potential strategy for combating hepatocellular carcinoma (HCC) metastasis. PMID: 27858335 these studies revealed that GP73 promotes hepatitis C virus (HCV) secretion by directly mediating the interaction of ApoE with HCV replication complex through binding with HCV NS5A. PMID: 27697522 Significantly higher serum levels of GP-73 and PIVKA-II were detected in the hepatocellular carcinoma patients than in controls. PMID: 28276727 The critical role of GP73 in hepatocellular carcinoma invasion, epithelial-mesenchymal transition and metastasis PMID: 28075476 Results show that overexpression of GP73 in hepatocellular carcinoma cell (HCC) line retrieved the expression of epithelial-mesenchymal transition (EMT) markers, and promoted cell motility and invasion. High expression of GP73 was also found in HCC tissues with metastasis providing evidence for an important role of GP73 in HCC metastasis. PMID: 26820712 Serum GP73 had limited diagnostic value for HBV-related liver cancer. The combined use of serum GP73 and AFP levels improved the diagnostic efficacy. PMID: 26617863 GP73 enhances MMP-13 expression through cAMP responsive element binding protein (CREB)-mediated transcription activation. Levels of GP73 and MMP-13 are increased and positively correlated in human HCC tissues. Augmented MMP-13 potentiates HCC cell metastasis. PMID: 26378022 the specific antibody could block the binding of A10-2 to GP73, and the specific binding of A10-2 to GP73 was also supported by the observation that several tumor cell lines exhibited variable expression level of GP73. PMID: 26583119 Transcatheter arterial chemoembolization significantly increased GP73 expression in patients with hepatocellular carcinoma. PMID: 26256086 GP73 and AFP-L3 are superior biomarkers to aid the diagnosis of small PHC with negative AFP. The combined detection of biomarkers improved the diagnostic accuracy. PMID: 26406957 The results of this meta-analysis showed that serum GP73 + AFP exhibited significantly higher diagnostic accuracy for HCC than did serum GP73 or AFP alone. PMID: 26441340 Sublingual vein parameters and AFP, AFP-L3, and GP73 serum gene expression facilitate early diagnosis of patients with hepatocellular carcinoma. PMID: 26125916 GOLPH2 may be a useful tissue biomarker for oesophageal disease. PMID: 26461057 a GP73 assay is not suitable for discriminating between primary malignant and benign tumors of the liver. PMID: 25033446 Increased expression of GP73 promotes proliferation and migration of hepatocellular carcinoma cell lines and growth of xenograft tumors in mice. PMID: 25980751 Results show that GOLPH2 is upregulated in Gastric cancer and correlated with shorter overall survival suggesting that GLPH2 is associated with the development and progression of the disease. PMID: 25119897 serum GP73 was found to be correlated with liver pathological grading and staging in patients with CHB, and may be an effective indicator for the evaluation of disease progression. PMID: 25524053 GP73 may play an important role in the inhibitory regulation of autophagy. PMID: 25527157 GOLM1 was directly regulated by miR-27b in prostate cancer cells PMID: 25115396 The variation trend of gp73 in chronic liver disease may indicate that monitoring of serum gp73 is helpful to diagnose cirrhosis in population with chronic HBV infection. PMID: 25168922 GP73 might play an important role in proliferation and apoptosis in hepatocellular carcinoma cells. PMID: 25170213 Studied the serum levels of GP73 in patients with HBV-ACLF. Found concentrations of GP73 in patients with HBV-ACLF (285.3 +/- 128.5 ng/mL) were markedly higher than HCC patients (159.1 +/- 105.8 ng/mL),CHB patients (64.65 +/- 44.99 ng/mL),and healthy controls. PMID: 24560809 The expression levels of GOLPH2 and IL-12A were negatively correlated. PMID: 24289573 The results demonstrate the critical function of GP73 in HCV secretion and provide new insights into the therapeutic design of antiviral strategies. PMID: 24608522 Data demonstrate that chimera GOLM1-MAK10 encodes a secreted fusion protein. Mechanistic studies reveal that GOLM1-MAK10 is likely derived from transcription read-through/splicing rather than being generated from a fusion gene. PMID: 24243830 Overexpression of GOLM1 is associated with hepatocellular carcinoma. PMID: 23838921 Loss of the tumor-suppressive miR-143/145 cluster enhanced cancer cell migration and invasion in PCa through directly regulating GOLM1. PMID: 24284362 GP73 is involved in the regulation of epithelial-mesenchymal transformation and invasiveness of hepatocellular carcinoma. PMID: 24313979 The usefulness of serum Transforming growth factor-beta1 (TGF-beta1), Glypican-3 (GPC3), and Golgi protein-73 (GP73) mRNAs as early biomarkers in HCC Egyptian patients, was investigated. PMID: 24186850 GP73 is a potential marker for evaluating AIDS progression and antiretroviral therapy efficacy. PMID: 24068434 Serum GP73 has a relatively high diagnostic accuracy in primary hepatic carcinoma with better sensitivity and high-specificity than alpha-fetoprotein.[review] PMID: 24779292 Serum GP73 were increased in patients with fatty liver disease. PMID: 24579464 GP73 is down-regulated in gastric cancer and associated with tumor differentiation. PMID: 23742050 GP73 may be a marker for diagnosing significant fibrosis in patients with chronic HBV infections, and may be a new contributor to fibrogensis. PMID: 23418424 GP73 content of liver cancer patients was significantly higher than the chronic hepatitis, cirrhosis patients and controls. PMID: 23627036

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.