Recombinant Human G1/S-Specific Cyclin-D2 (CCND2) Protein (GST)

Name: Recombinant Human G1/S-Specific Cyclin-D2 (CCND2) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-09266P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human G1/S-Specific Cyclin-D2 (CCND2) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P30279
Target Symbol	CCND2
Synonyms	CCND 2; ccnd2; CCND2_HUMAN; CyclinD2; G1/S specific cyclin D2; G1/S-specific cyclin-D2; KIAK0002; MGC102758; MPPH3
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
Expression Range	1-289aa
Protein Length	Full Length
Mol. Weight	60.1kDa
Research Area	Cell Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Regulatory component of the cyclin D2-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals.
Subcellular Location	Nucleus. Cytoplasm. Nucleus membrane.; [Isoform 2]: Cytoplasm.
Protein Families	Cyclin family, Cyclin D subfamily
Database References	HGNC: 1583 OMIM: 123833 KEGG: hsa:894 STRING: 9606.ENSP00000261254 UniGene: PMID: 29945347 Our results indicate that miR-4317 can reduce Non-small cell lung cancer (NSCLC) cell growth and metastasis by targeting FGF9 and CCND2. These findings provide new evidence of miR-4317 as a potential non-invasive biomarker and therapeutic target for NSCLC. PMID: 30227870 miR-29b suppressed cellular proliferation and promoted apoptosis of pulmonary artery smooth muscle cells, possibly through the inhibition of Mcl-1 and CCND2. PMID: 29662889 Our results provide novel insights into the function of EBNA3C on cell progression by regulating the cyclin D2 protein and raise the possibility of the development of new anticancer therapies against EBV-associated cancers. PMID: 29997218 present study provides novel insight into the genetics of myeloid malignancies, namely Philadelphia-negative neutrophilic leukemias. Our work suggests that in addition to the commonly recurring classes of genes that are frequently mutated in these malignancies, recurrent mutations in cyclin D2, and perhaps other cell cycle regulators, have biochemical and therapeutic consequences and may play important roles in the pathog PMID: 28630439 focal gain of CCND2 and adjacent regions was seen in 8 of 9 (89%) gemistocytic IDH mutant astrocytomas PMID: 28000032 data indicate that linc00598 plays an important role in cell cycle regulation and proliferation through its ability to regulate the transcription of CCND2. PMID: 27572135 NAV2 and CCND2 are novel candidate prognostic markers in uterine leiomyosarcoma and uterine low-grade endometrial stromal sarcoma, respectively. PMID: 28643014 The surface immune molecule CD274 plays a critical role in the proliferation of leukemia-initiating cells, LICs. The CD274/JNK/Cyclin D2 pathway promotes the cell cycle entry of LIC. PMID: 27855694 High CCND2 expression is associated with Metastasis of Colorectal Cancer. PMID: 28933597 Mutation in the CCND2 gene is associated with acute myeloid leukemia. PMID: 27843138 data suggested that loss of CCND2 expression is closely associated with the promoter aberrant methylation PMID: 27583477 MiR-497 significantly suppressed cell proliferation by arresting the cell cycle through the CCND2 protein. PMID: 27918592 cyclin D2 acts as regulator of cell cycle proteins affecting SAMHD1-mediated HIV-1 restriction in non-proliferating macrophages. PMID: 27541004 CCND2-AS1 promotes glioma cells proliferation and growth in a process that involves Wnt and beta-catenin PMID: 27923660 CCND1 is downregulated, whereas CCND2 is not, following ionizing radiation (IR) . Both CCND1- and CCND2-expressing MM cells arrested in S/G2/M, and did not differ in other cell-cycle proteins or sensitivity to IR.Differential expression of D-cyclin does not appear to affect cell-cycle response to IR, and is unlikely to underlie differential sensitivity to DNA damage. PMID: 27146121 Bioinformatics analysis further revealed cyclin D2 (CCND2) and AKT3, putative tumor promoters, as potential targets of miR610. Data from reporter assays showed that miR610 directly binds to the 3'untranslated PMID: 26782072 this study shows that miR-124-3p may negatively regulate the transcription of the STAT3 by interfering with its 3'UTR, and the degradation of STAT3 affects its downstream expression of such as p-STAT3, CCND2 and MMP-2 PMID: 26707908 these results highlight the impact of CCND2 3'UTR shortening on miRNA-dependent regulation of CCND2 in multiple myeloma. PMID: 26341922 The results do not support our hypothesis that common germline genetic variants in the CCND2 genes is associated with the risk of developing medulloblastoma. PMID: 26290144 miR-198 inhibited HaCaT cell proliferation by directly targeting CCND2. PMID: 26225959 CCND2 was identified as a putative target gene for SMYD3 transcriptional regulation, through trimethylation of H4K20.Our results support a proto-oncogenic role for SMYD3 in prostate carcinogenesis, mainly due to its methyltransferase enzymatic activity. PMID: 25980436 Up-regulation of clyclinD2 regulates laryngeal squamous cell carcinoma cell growth. PMID: 26221902 Treatment of rSCC-61 and SCC-61 with the DNA hypomethylating agent 5-aza-2'deoxycitidine increased CCND2 levels only in rSCC-61 cells, while treatment with the control reagent cytosine arabinoside did not influence the expression of this gene PMID: 25961636 miR206 inhibits glioma progression via the regulation of cyclinD2 and that miR206 may be a novel biomarker with potential for use as a therapeutic target in gliomas. PMID: 25572712 the dysregulation of miR-206-CCND2 axis may contribute to the aggressive progression and poor prognosis of human gastric cancer. PMID: 25960238 OY-TES-1 downregulation in liver cancer cells promotes cell proliferation by upregulating CCND2 and CDCA3. PMID: 25673160 Cyclin D2 hypermethylation is associated with breast cancer. PMID: 25824739 Methylation changes were enriched in MSX1, CCND2, and DAXX at specific loci within the hippocampus of patients with schizophrenia and bipolar disorder. PMID: 25738424 Study establishes that a low-frequency allele in CCND2 halves the risk of type 2 diabetes primarily through enhanced insulin secretion. PMID: 25605810 Stepwise Cox regression modelling suggested that the methylation of genes HSPB1, CCND2 and DPYS contributed objective prognostic information to Gleason score and PSA with respect to prostate cancer-related death. PMID: 25193387 study establishes that a low frequency allele in CCND2 halves the risk of type 2 diabetes primarily through enhanced insulin secretion PMID: 25605810 results provide evidence that CCND2 polymorphism rs3217927 may be involved in the etiology of childhood ALL, and the GG genotype of rs3217927 may modulate the genetic susceptibility to childhood ALL in the Chinese population. PMID: 24743557 miR-154 plays a prominent role in prostate cancer proliferation by suppressing CCND2 PMID: 23428540 Together, this study has uncovered a positive role of cyclin D2 in hepatitis B virus replication. PMID: 24992041 De novo CCND2 mutations leading to stabilization of cyclin D2 cause megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome. PMID: 24705253 Study reveals molecular insight into how the Ets family transcription factor Pea3 favors EMT and contributes to tumorigenesis via a negative regulatory loop with Cyclin D2, a new Pea3 target gene. PMID: 23989931 A low-frequency (1.47%) variant in intron 1 of CCND2, rs76895963[G], reduces risk of type 2 diabetes by half (odds ratio (OR) = 0.53, P = 5.0 x 10(-21)) and is correlated with increased CCND2 expression. PMID: 24464100 Frequent aberrations of CCND2 and RB1 is associated with intracranial germ cell tumors PMID: 24249158 our results demonstrate that cyclin D2 has a critical role in cell cycle progression and the tumorigenicity of glioblastoma stem cells PMID: 22964630 Cyclin D2 is a direct target of miR-206 in breast cancer cells PMID: 23466356 Experimental verification of the ability of this small RNA molecule to regulate the expression of CCND2, a gene with documented oncogenic activity, confirms its functional role as a miRNA. PMID: 22954617 CCND2 gene polymorphism is associated in the pathogenesis of colorectal cancers. PMID: 23266556 miR-206 could suppress gastric carcinoma cell proliferation at least partially through targeting cyclinD2 expression. PMID: 23348698 Chromosomal rearrangements of the CCND2 locus were detected in 55% of the cases, with an IG gene as partner in 18 of 22, in particular with light chains (10 PMID: 23255553 Transgenic K562 cells have distinct gene expression profiles both in steady state and during terminal erythroid differentiation, with GATA1s expression characterised by lack of repression of MYB, CCND2 and SKI. PMID: 22853316 CCND2, was the most "dietary sensitive" genes, as methylation of their promoters was associated with intakes of at least two out of the eight dietary methyl factors examined. PMID: 22048254 High expression of cyclin D2 is associated with mantle cell lymphoma. PMID: 21479697 Single nucleotide polymorphisms of CCND2, RAD23B, GRP78, CEP164, MDM2, and ALDH2 genes were significantly associated with development and recurrence of hepatocellular carcinoma in Japanese patients with hepatitis C virus. PMID: 22004425 The authors demonstrate that Cyclin D2 is also expressed in the developing human cortex within similar domains, thus indicating that its role as a fate determinant is ancient and conserved. PMID: 22395070

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human G1/S-Specific Cyclin-D2 (CCND2) Protein (GST)

Recombinant Human G1/S-Specific Cyclin-D2 (CCND2) Protein (GST)

Product Overview

Target Details

FAQs