Recombinant Human Fibroblast Growth Factor 7 (FGF7), Active

Name: Recombinant Human Fibroblast Growth Factor 7 (FGF7), Active
Brand: Beta LifeScience
SKU: BLC-05940P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: Buy cytokines, chemokines, and growth factors for research online, Explore high-quality enzymes for research and supplementation, Featured enzyme molecules, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, Kinase

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Fibroblast Growth Factor 7 (FGF7), Active is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to bind Human FGFR3 in functional ELISA is less than 5 ug/ml.
Uniprotkb	P21781
Target Symbol	FGF7
Synonyms	FGF 7; FGF-7; Fgf7; FGF7_HUMAN; Fibroblast growth factor 7; HBGF 7; HBGF-7; HBGF7; Heparin binding growth factor 7; Heparin-binding growth factor 7; Keratinocyte growth factor; KGF
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	Tag-Free
Complete Sequence	CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Expression Range	32-194aa
Protein Length	Full Length of Mature Protein
Mol. Weight	19.1 kDa
Research Area	Signal Transduction
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 8.0
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.
Subcellular Location	Secreted.
Protein Families	Heparin-binding growth factors family
Database References	HGNC: 3685 OMIM: 148180 KEGG: hsa:2252 STRING: 9606.ENSP00000267843 UniGene: PMID: 29970688 Findings suggest that excessive KGF and KGFR synthesis may contribute to the hyperproliferative state in cholesteatoma and could explain the pathological difference between cholesteatoma and CSOM. PMID: 29556625 Results suggest that fibroblast growth factor 7 may stimulate endometrial stromal cells proliferation and insulin-like growth factor-binding protein 1 and prolactin expressions through ERK and JNK signal pathways in an autocrine manner. PMID: 28270036 The stability and activity of rhKGF mutants were analyzed using GROMACS molecular dynamics (MD) simulations and docking tools, respectively. The results showed that N159S (N105S in rhKGF sequence) and I172V (I118V in rhKGF) substitutions caused an increased stability and affinity of the rhKGF to Fibroblast growth factor receptor 2 (FGFR2). PMID: 28093295 Tregs isolated from human lung tissue can be stimulated ex vivo to induce kgf expression. PMID: 28296468 FGF7 stimulation of cell invasion and migration was partially suppressed by the FGFR2 knockdown. In addition, FGF7/FGFR2 upregulated THBS1, and cell invasion and migration were decreased by knockdown of THBS1 PMID: 28339036 Suppression of miR-219-5p may benefit the liver regeneration and prevent cirrhosis through increasing KGF. PMID: 27855391 This study evaluated the expression of FGF7, AhR, and CYP1A1 in colorectal cancer cells and revealed a new mechanism by which KGF promotes cell proliferation through the AhR-cyclin D1 pathway in colon cancer cells. PMID: 26514676 KGF expression induced epithelial cell proliferation, reaching a peak level at day 4 and then decreased later, while in the long-term model, KGF expression in the EAC led to middle ear cholesteatoma formation PMID: 25138153 In the current study, conditioned media and chemically defined media with recombinant human keratinocyte growth factor (KGF) could induce hUC-MSC differentiation into sweat gland-like cells (SGCs). PMID: 26574554 Coexpression of KGF and MMP-9 in gastric cancer could be a useful prognostic factor, and MMP-9 might also serve as a novel target for both prognostic prediction and therapeutics. PMID: 26350198 FGF7 over expression is associated with advanced clinical features in patients with upper tract and bladder urothelial carcinoma PMID: 25623741 Data indicate the key roles played, on the melanosome transfer in normal skin, by KGF/FGF7 released by dermal fibroblasts and by its receptor KGFR/FGFR2b expressed and activated on the epidermal keratinocytes. PMID: 25313018 First evidence of a role of FGF7 in the regulation of sequential steps of the autophagic process and strengthen the hypothesis of a direct interplay between autophagy and differentiation. PMID: 24577098 An SNP in FGF7 is associated with an increased risk of chronic obstructive pulmonary disease. PMID: 22796760 These findings indicate that topically delivered KGF-1 DNA plasmid can increase epithelial thickness and strength, demonstrating the potential of this approach to restore compromised skin. PMID: 24434934 Recombinant keratinocyte growth factor 1 in tobacco potentially promotes wound healing in diabetic rats. PMID: 24783215 Sustained effect of KGF on cell survival and proliferation could be attributed to its ability to inhibit p53, retinoblastoma, caspases, and p27(kip) functions in apoptosis and cell cycle arrest. PMID: 24426773 FGF7 stimulates osteogenic differentiation, but not proliferation, in embryonic stem cells, by activating ERK/Runx2 signaling. PMID: 24026476 This paper provides an overview of the knowledge on molecular properties, biological functions and the ecent findings on clinical application of EGF7. [review] PMID: 24188496 High FGF7 expression is associated with ameloblastoma. PMID: 24002438 IL-19 is important for cutaneous wound healing because it upregulates KGF expression. PMID: 23582717 FGF7 supports hematopoietic stem and progenitor cells and leukemia-initiating cells indirectly via FGFR2IIIb expressed on stromal cells. PMID: 24051090 The aim of this study was to determine whether the K-sam gene and keratinocyte growth factor (KGF) expression may be used to identify malignant tumors with a poor prognosis. PMID: 23545898 KGF could up-regulate IL-7 expression through the STAT1/IRF-1, IRF-2 signaling pathway, which is a new insight in potential effects of KGF on the intestinal mucosal immune system. PMID: 23554911 The LTA downstream segment alternate core promoter was active only after specific cellular stimulation and was the major promoter used when human T cells were stimulated with TGF-beta1 and fibroblast growth factor-7. PMID: 23547113 Increased KGF expression promotes fibroblast activation in a double paracrine manner resulting in cutaneous fibrosis. PMID: 23096718 results implicate pericryptal myofibroblast-derived paracrine KGF and largely autocrine amphiregulin in the upregulation of claudin-2 in Caco-2 epithelial monolayers and consequent disruption of tight junction integrity PMID: 22946653 Keratinocyte growth factor up-regulates Interleukin-7 expression following intestinal ischemia/reperfusion in vitro and in vivo. PMID: 22949940 the activation of the stromal fibroblasts present in the pathological tissue, and the consequent increased secretion of KGF, play a crucial role in the deregulation of the epidermal proliferation and differentiation. PMID: 22481617 these data suggest that FGF7 is a novel regulator of CYP7A1 expression in hepatocytes and may prevent hepatocytes from accumulating toxic bile acids during liver injury and fibrosis. PMID: 22713451 Repression of Ink4a in aged (ETPs) Early T-cell progenitors results in their partial rejuvenation and this can be accomplished by in vivo fibroblast growth factor 7 administration. PMID: 22555975 In COPD, SNPs (rs12591300 and rs4480740) were significantly associated with COPD in an independent population (combined p values of 7.9E-7 and 2.8E-6). Increased lung tissue FGF7 expression was associated with worse measures of lung function. PMID: 21921092 FGF7 enhanced keratinocyte proliferation and its expression was increased when NCTC 2544 cells were subjected to treatments with plantaricin A preparations or hyaluronic acid. PMID: 21782870 Carcinoma-associated fibroblasts promotes the proliferation of a lingual carcinoma cell line by secreting keratinocyte growth factor. PMID: 21340484 KGF may have a role in ameliorating radiation-induced pulmonary injury in rats PMID: 21436609 These results suggest that the growth factors HGF and KGF may play a role in enhancing IL-1-stimulated production of IL-8 by epithelial cells during mucosal inflammations. PMID: 21082280 KGF increases pigment production and deposition in melanocytes in vitro and in vivo PMID: 19780816 The upregulation of KGF/KGFR might induce the formation of rete ridges and hyperpigmentation in solar lentigines. PMID: 20620021 Modulation of calprotectin in human keratinocytes by keratinocyte growth factor and interleukin-1alpha. PMID: 20065999 the expression of keratinocyte growth factor (KGF) and keratinocyte growth factor receptor (KGFR) in Hela cells PMID: 17593825 KGF and KGFR are both expressed in CaSki cells. Autocrine and recombinant human KGF affect cell proliferation and migration. PMID: 17953372 keratinocyte growth factor works via an inducible lentivirus to protect bone marrow cells against bleomycin-induced pulmonary fibrosis PMID: 19956603 The goal of this study was to elucidate the control mechanisms by which exogenous proteins regulate keratinocyte growth factor (KGF) expression in fibroblasts adhered to differing substrates. PMID: 20036421 The effect of KGF on limbal epithelial cell growth is mediated by upregulation of DeltaNp63alpha through the p38 pathway. PMID: 19920075 KGF induced proliferation but did not cause significant differentiation of 3 hematopoietic cell lines and bone marrow cells transduced with human K-sam. PMID: 11937263 play important roles in lung development, lung inflammation, and repair. PMID: 11943656 keratinocyte growth factor (KGF), a key stimulator of epithelial cell proliferation during wound healing, preferentially binds to collagens I, III, and VI. PMID: 11973338 KGF may hold promise for the treatment of very premature neonates with bronchopulmonary dysplasia. PMID: 12016100 Following activation by KGF binding, KGF and the KGF receptor remain associated in active complexes through the endocytic pathway, which is described. PMID: 12122441

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.