Recombinant Human Fibroblast Growth Factor 12 (FGF12) Protein (GST)

Name: Recombinant Human Fibroblast Growth Factor 12 (FGF12) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-09206P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Buy cytokines, chemokines, and growth factors for research online, Explore high-quality enzymes for research and supplementation, Featured enzyme molecules, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, Kinase

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Fibroblast Growth Factor 12 (FGF12) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P61328
Target Symbol	FGF12
Synonyms	EIEE47; FGF-12; Fgf12; FGF12_HUMAN; FGF12B; FHF-1; FHF1; Fibroblast growth factor 12; Fibroblast growth factor 12B; Fibroblast growth factor FGF 12b; Fibroblast growth factor homologous factor 1; Myocyte activating factor; Myocyte-activating factor
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Expression Range	1-181aa
Protein Length	Full Length of Isoform 2
Mol. Weight	47.4kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Involved in nervous system development and function. Involved in the positive regulation of voltage-gated sodium channel activity. Promotes neuronal excitability by elevating the voltage dependence of neuronal sodium channel SCN8A fast inactivation.
Subcellular Location	Nucleus.
Protein Families	Heparin-binding growth factors family
Database References	HGNC: 3668 OMIM: 601513 KEGG: hsa:2257 STRING: 9606.ENSP00000413496 UniGene: PMID: 29049013 In this study, the authors observed that rs1460922 of FGF12 was significantly associated with VT and identified that a de novo variation of FGF12 may be an important genetic risk factor for the pathogenesis of VT. PMID: 28775062 FGF12, RBFOX1, and MIR302F could be important in human heterotaxy, because they were noted in multiple cases. Further investigation into genes involved in the NODAL, BMP, and WNT body patterning pathways and into the dosage effects of FGF12, RBFOX1, and MIR302F is warranted. PMID: 27637763 FGF12 strongly induced the quiescent and contractile vascular smooth muscle cell phenotype and directly promoted VSMC lineage differentiation. PMID: 27470512 Results demonstrate that gain-of-function FHF mutations can cause neurologic disorder, and expand the repertoire of genetic causes (FHF1) and mechanisms (altered Nav gating) underlying early-onset epileptic encephalopathies and cerebellar atrophy PMID: 27164707 Nine SNPs of the FGF12 gene were associated with Kashin-Beck disease. PMID: 26290467 Data indicate that SCN5A variant (Nav1.5) p.H1849R affected interaction with fibroblast growth factor homologous factor (FHFs). PMID: 26392562 Q7R-FGF12 is a disease-associated BrS mutation. Moreover, these data suggest for the first time that FHF effects on Na(+) and Ca(2+) channels are separable. PMID: 24096171 VAX1 rs10787760, rs6585429 and rs1871345 polymorphisms may be involved in nonsyndromic cleft lip with or without cleft palate in Brazilian patients, but there is no association with polymorphisms in FGF12, VCL, or CX43 PMID: 23679094 PHOX2B, FGF12 and GAD2 genes are hypermethylated in colorectal neoplastic tissue PMID: 22552777 exogenous FGF12 can play a role in tissues by translocating into cells through the plasma membrane PMID: 21518765 Fibroblast growth factor homologous factor 1B (FHF1B) modulated the cardiac sodium channel Nav1.5. PMID: 12401812 x-ray crystal structure of FHF1b PMID: 12815063 Data describe the biophysical characterization and folding of fibroblast growth factor homologous factor-1b (FHF-1b) in comparison with acidic fibroblast growth factor (FGF-1), and show that FHF-1 is significantly more stable than FGF-1. PMID: 18289114 These findings suggest that FGF12 intracellularly suppresses radiation-induced apoptosis in mast cells independently of IB2. PMID: 18525161

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.