Recombinant Human Fibroblast Growth Factor 10 (FGF10) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-04353P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Fibroblast Growth Factor 10 (FGF10) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-04353P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Fibroblast Growth Factor 10 (FGF10) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb O15520
Target Symbol FGF10
Synonyms BB213776 ; fd11d03; FGF 10; FGF-10; FGF10; FGF10_HUMAN; Fibroblast growth factor 10; Keratinocyte growth factor 2; KGF 2; Produced by fibroblasts of urinary bladder lamina propria; wu:fd11d03; zgc:109774
Species Homo sapiens (Human)
Expression System E.coli
Tag N-GST
Target Protein Sequence QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
Expression Range 38-208aa
Protein Length Full Length of Mature Protein
Mol. Weight 46.3kDa
Research Area Cardiovascular
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing.
Subcellular Location Secreted.
Protein Families Heparin-binding growth factors family
Database References

HGNC: 3666

OMIM: 149730

KEGG: hsa:2255

STRING: 9606.ENSP00000264664

UniGene: PMID: 29053399

  • We have revealed significant association of FGFR2 and MAP3K1 polymorphisms with breast cancer. PMID: 29372690
  • data suggest that the strongest signal of association at 5p12 is mediated through coordinated activation of FGF10 and MRPS30, two candidate genes for breast cancer pathogenesis PMID: 27640304
  • Fgf10 signaling has an essential role in the formation of lipofibroblasts during late lung development PMID: 26511927
  • Expression of Fibroblast Growth Factor 10 is correlated with poor prognosis in gastric adenocarcinoma. PMID: 26268776
  • FGF10 has a role in protecting neuron against oxygen-glucose deprivation injury through inducing heme oxygenase-1 PMID: 25446127
  • Data identify autocrine activation of FGF signaling as an essential mechanism in promoting Pten-deficient skin tumors. PMID: 24582960
  • The therapeutic potential of the FGF10 treatment. PMID: 24865969
  • FGF10 plays an important role for tumor growth by both paracrine and autocrine manner. PMID: 24320134
  • The findings show that immunohistochemistry with FGF10, FGFR2b, or SHH could be useful in differentiating CCAM from type I PPB, when a child presents with a focal cystic lung lesion. PMID: 24004862
  • Paracrine FGF10 signaling stimulates the differentiation of human stem cell into urothelial cells. PMID: 23949743
  • High FGF10 expression is associated with ameloblastoma. PMID: 24002438
  • Three FGF10 single nucleotide polymorphisms in complete linkage disequilibrium--rs339501, rs12517396, and rs10462070--were associated with extreme myopia in the Japanese population. PMID: 24265547
  • FGF-10 expression during the development of the human hindgut and anorectum suggests that it may play a role in hindgut and anorectal morphogenesis. PMID: 23774963
  • The sclera of myopic eyes had higher FGF10 levels. The risk G allele of SNP rs339501 was associated with extreme myopia in human and caused a higher gene expression in the luciferase assay. PMID: 23599340
  • the posttranslational and transcriptional mechanisms underlying stimulation of P-glycoprotein function and expression by keratinocyte growth factor-2 (KGF2) that may contribute to the beneficial effects of KGF2 in intestinal inflammatory disorders PMID: 23328208
  • tooth agenesis had increased risk of a family history of cancer. tooth agenesis was associated with positive self-reported family history of cancer and variants in FGF10. PMID: 23169889
  • Identification of FGF-10 at both protein and mRNA levels in ovaries from fetuses, girls, and women suggests that FGF-10 contributes to preantral follicle development; FGF-10 is expressed in both granulosa cells and oocytes. PMID: 22877940
  • Our data suggest that common variants in FGF10 increase the risk for a wide range of non-syndromic limb deficiencies. PMID: 22965740
  • [review] FGF10 mediates biological responses by activating FGF receptor 2b (FGFR2b) in a paracrine manner. PMID: 21696361
  • The relationship between human ISL1 and FGF10 within the embryonic time window during which the linear heart tube remodels into four chambers, was examined. PMID: 22303449
  • Investigation of the pulmonary functions of COPD patients heterozygous for loss of function mutations in the FGF10 gene was performed. The patients show a significant decrease in lung function parameters when compared to control values. PMID: 21742743
  • Gremlin-mediated BMP inhibition results in activation of epithelial cells and transient fibrosis, but also induction of epithelium-protective FGF10 PMID: 20705941
  • FGF2 and FGF10 regulate migratory activity of ovine trophoblast cells through MAPK-dependent pathways. PMID: 21310815
  • FGF10 can promote the adipogenesis effect in situ. PMID: 19915940
  • There was no association among gene FGFR1 rs13317, p. E467K, p. M369I, p. S393S and gene FGF10 rs1448037 and nonsyndromic cleft lip with or without palate in Chinese population. PMID: 19727229
  • These results suggested that Thr-114 is a crucial functional residue for FGF10, and mutating Thr-114 to Ala or Arg would lead to great decrease in receptor-binding affinity and biological activity of FGF10. PMID: 20036575
  • FGF10 upregulates Na(+)-K(+)-exchanging ATPase via the MAPK pathway. PMID: 12804770
  • FGF-10 attenuates H2O2-induced alveolar epithelium DNA damage by mechanisms that involve activation of Grb2-SOS/Ras/RAF-1/ERK1/2 pathway and DNA repair. PMID: 14975937
  • Fgf10 mRNA is overexpressed in a subset of human breast carcinomas. PMID: 15208658
  • Data validate the symmetric two-end model of fibroblast growth factor (FGF) receptor (FGFR) dimerization and FGF binding and argue against the asymmetric model of FGFR dimerization. PMID: 15632068
  • We suggest that haploinsufficiency for FGF10 during a crucial stage of development results in ALSG. PMID: 15654336
  • Human embryonic pancreatic mesenchyme expresses FGF10, which might be used used to expand human embryonic pancreatic epithelial cells. PMID: 15690149
  • Human recombinant FGF10 maintains murine Notch activation and induces the expansion of murine pancreatic precursors while blocking their differentiation. PMID: 16323074
  • Localization of the FGF-10 receptor to the urothelial layer is clinically significant because intravesical administration of FGF-10 may provide a means to control the turnover of transitional epithelium in bladder disorders such as interstitial cystitis. PMID: 16597614
  • Activation of Toll-like receptor 2 (TLR2) or Toll-like receptor 4 (TLR4) inhibited FGF-10 expression, leading to abnormal saccular airway morphogenesis. PMID: 17071719
  • R80S and G138E mutations are associated with aplasia of the lacrimal and salivary glands. PMID: 17213838
  • a nuclear localization signal-like motif of FGF-10 is a partial determinant of its intracellular distribution and is necessary for its mitogenic activity PMID: 17471512
  • Trophoblast outgrowth and invasion (part of placental villi sprouting) at the fetal maternal interface is in part under delicate control of FGF 10 and Sprouty 2. PMID: 17496316
  • Results suggest that Lacrimo-auriculo-dento-digital syndrome is caused by reduced activity of the fibroblast growth factor 10 (FGF10)-FGF receptor 2 signaling pathway. PMID: 17682060
  • Expression in diverse niches of adult brain of Fgf10-lacZ reporter mice implicates Fgf10 in control of neurogenesis and/or conservation of neurogenic potential. PMID: 18329286
  • It cannot be ruled out that other genes involved in the signalling pathway of FGF10 may contribute to the formation of these congenital malformations. PMID: 18587586
  • Stromal FGF10 induces migration and invasion in pancreatic cancer cells through interaction with FGFR2, resulting in a poor prognosis. PMID: 18594526
  • family-based approach revealed an intronic variation of the FGF10 gene causing aplasia of lacrimal and salivary glands-syndrome PMID: 19102732
  • Disruption of localized pattern of mesenchymal fibroblast growth factor 10 expression results in impairment of lung branching morphogenesis, which progresses to emphysematous airspaces in adults. PMID: 19115389
  • Fgf10 is a strong causative candidate for defects observed in Apert syndrome since its genetic knockdown in a mouse model of Apert syndrome results in the rescue of the skeletal and visceral defects associated with this congenital disease. PMID: 18773495
  • An analysis of the distribution and fate of Fgf10-expressing cells in the adult mouse brain suggests that Fgf10 may have critical regulatory roles in stem cell function and generation of new neurons in diverse areas of the adult brain. PMID: 18773495
  • TGFbeta1 caused a rapid and transient decrease in Fgf10 mRNA levels in primary prostatic cells. Deletion analysis of the Fgf10 promoter identified a region that mediated a proportion of promoter activity as well as promoter down-regulation by TGFbeta1. PMID: 14726452

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $139
    Sale
    SDS-PAGE analysis of Human USP9X (Ubiquitin Carboxyl-Terminal Hydrolase 9X) - Recombinant Protein, CAT# BLT-07739P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human USP9X (Ubiquitin Carboxyl-Terminal Hydrolase 9X) - Recombinant Protein
    • Molecule: USP9X;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-GST;
    • Sequence: 1554-1995aa;
    CAT#: BLT-07739P

    Save $139
    Sale
    SDS-PAGE analysis of Human GFAP (Glial Fibrillary Acidic Protein) - Recombinant Protein, CAT# BLT-07373P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human GFAP (Glial Fibrillary Acidic Protein) - Recombinant Protein
    • Molecule: GFAP;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-432aa;
    CAT#: BLT-07373P

    Save $139
    Sale
    SDS-PAGE analysis of Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein, CAT# BLT-08789P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein
    • Molecule: SFTPA2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 21-248;
    CAT#: BLT-08789P

    Save $139
    Sale
    SDS-PAGE analysis of Human CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) - Recombinant Protein, CAT# BLT-07667P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) - Recombinant Protein
    • Molecule: CFTR;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 359-858aa;
    CAT#: BLT-07667P

    Save $139
    Recently viewed