Recombinant Human Fibroblast Growth Factor 1 (FGF1) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04340P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Fibroblast Growth Factor 1 (FGF1) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04340P
Size

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Fibroblast Growth Factor 1 (FGF1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P05230
Target Symbol FGF1
Synonyms Acidic fibroblast growth factor; aFGF; Beta endothelial cell growth factor; Beta-endothelial cell growth factor; ECGF; ECGF beta; ECGF-beta; ECGFA; ECGFB; Endothelial Cell Growth Factor alpha; Endothelial Cell Growth Factor beta; FGF 1; FGF alpha; Fgf1; FGF1_HUMAN; FGFA; Fibroblast Growth Factor 1 Acidic; Fibroblast growth factor 1; GLIO703; HBGF 1; HBGF-1; HBGF1; Heparin binding growth factor 1; Heparin binding growth factor 1 precursor; Heparin-binding growth factor 1
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Expression Range 16-155aa
Protein Length Full Length of Mature Protein
Mol. Weight 31.8kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV:ITGB3. Its binding to integrin, subsequent ternary complex formation with integrin and FGFR1, and the recruitment of PTPN11 to the complex are essential for FGF1 signaling. Induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2 and AKT1. Can induce angiogenesis.
Subcellular Location Secreted. Cytoplasm. Cytoplasm, cell cortex. Cytoplasm, cytosol. Nucleus.
Protein Families Heparin-binding growth factors family
Database References

HGNC: 3665

OMIM: 131220

KEGG: hsa:2246

STRING: 9606.ENSP00000338548

UniGene: PMID: 29490650

  • Modification of the heparin-binding region of FGF1 significantly improves the cardioprotective efficacy, even in the presence of heparin, identifying a novel FGF ligand available for therapeutic use in ischemic heart disease. PMID: 29016740
  • FGF1 protects neuroblastoma cells from p53-dependent apoptosis through an intracrine pathway regulated by FGF1 phosphorylation. PMID: 29048426
  • Specific heparin derivatives molecular recognition patterns by FGF1 have been reported. PMID: 27858202
  • Multiple stepwise linear regression analysis found serum level of FGF1 was dependent on anti-diabetic drugs, hemoglobin A1C, body mass index and sex. Serum level of FGF1 is associated with the decreased risk of obesity in human. PMID: 28303556
  • Our study suggests that the genetic variants of FGF1 rs34011, more so than FGF2 rs2922979, may play a role in PE pathogenesis in Tunisian women. PMID: 27324104
  • FGF1 and 2 strongly prevent the osteogenic commitment and differentiation of hBMSCs. PMID: 27305863
  • Transfected FGF1 promotes angiogenic proliferation. PMID: 28281780
  • These observations suggest a crucial role for cancer-associated fibroblasts and fibroblast growth factor-1/fibroblast growth factor receptor 4 signaling in the progression of ovarian cancer. the expression level of Snail1 and MMP3 was reduced, while the expression level of E-cadherin increased PMID: 28718374
  • Enzyme-linked immunosorbent assay was used to detect the levels of chemokine (C-X-C motif) ligand 12, chemokine (C-X-C motif) ligand 7, hepatocyte growth factor, and fibroblast growth factor 1 in the supernatants of the laryngeal squamous cell carcinoma and control cells. PMID: 28475003
  • fibroblast growth factor 1 (FGF1) to be synergistically induced by heat shock and wounding. PMID: 27638903
  • The results indicate that suramin blocks the interaction between hFGF1 and FGFR2 D2. PMID: 27387234
  • activation of AurA kinase through FGF1/FGFR signaling axis sustains the stem cell characteristics of glioblastoma cells. PMID: 27138904
  • Study showed that both aFGF and bFGF were highly expressed in cervical cancer tissues. In tumors of higher clinical stages, the expression of these factors was further enhanced, suggesting that they play a role in facilitating cervical cancer cell proliferation. PMID: 27966750
  • FGF1 may play a role in the pathogenesis of T2 diabetes mellitus. PMID: 26806193
  • anti-importin alpha1 antibody treatment suppressed the importin alpha1-FGF1 complex formation and ERK1/2 activation, resulting in decreased cell growth. This study provides novel evidence that functional importin alpha1 is located at the cell surface, where it accelerates the proliferation of cancer cells. PMID: 26887791
  • The mutational introduction of a novel Cys residue (Ala66Cys) that forms a stabilizing disulfide bond (i.e., cystine) with one of the extant Cys residues (Cys83) effectively eliminates one Cys while increasing overall stability. PMID: 27019961
  • The role of intracellular FGF1 is to protect the cell against stress conditions by providing an additional signal for cell survival, independently of receptor-activated signaling cascades. PMID: 26840910
  • Data suggest folding of FGF1 is critical for its nonclassical secretion via permeability of lipid bilayer; mutation of proline135 in C-terminus of FGF1 leads to partial unfolding/decrease in FGF1's ability to permeabilize phosphatidylserine bilayers. PMID: 26836284
  • The analysis identified a signaling axis between FGF signaling and the transcription factor Sox1, which is preferentially expressed in stem- and mesenchymal-like breast cancers. PMID: 26365194
  • FGF-1 synthesis and secretion by synovial fibroblasts were significantly increased in osteoarthritis. PMID: 26400350
  • expression of human FGF1 solely in beta-cells in fgf1(-/-) animals prevented overnutrition induced compensatory beta-cell differentiation. PMID: 26420862
  • Results show that stress functionally associates FGF1 with AHNAK2 and both proteins with the cytoskeleton and their co-localization in the vicinity of the cell membrane. AHNAK2 seems to be an important element of the FGF1 export pathway. PMID: 25560297
  • These findings suggest that the presence of FGF1 may serve as a prognostic indicator and a potential therapeutic target for non-small cell lung cancer patients, especially for lung squamous cell carcinoma. PMID: 26391572
  • FGF1 expression is increased in lung from idiopathic pulmonary fibrosis patients. PMID: 26138239
  • FGF1-FGFR1 axis promotes tongue squamous cell carcinoma metastasis through the epithelial-mesenchymal transition pathway PMID: 26362179
  • p120RasGAP shields Akt from deactivating phosphatases in FGF1 signaling, but loses this ability once cleaved by caspase-3. PMID: 26109071
  • Study presents a transcript profiling of remyelinated multiple sclerosis lesions and identified FGF1 as a promoter of remyelination PMID: 25589163
  • These results suggested that human FGF1B promoter was active in ependymal cells, neurons, and a portion of dopaminergic neurons PMID: 25104610
  • This review is focused on the role of HDGF in tumorigenesis and metastasis, and provides insight for application in clinical cancer therapy as well as its clinical implications as a prognostic marker in cancer progression. PMID: 25236340
  • the sulfate in position 6 of d-glucosamine was essential for the mitogenic activity but not for the interaction with FGF-1 PMID: 25015527
  • While results are awaited from these clinical investigations in squamous NSCLC and other disease settings, additional research is needed to elucidate the role of FGF/FGFR signaling in the biology of NSCLC of different histologies PMID: 24711160
  • FGF1 gene polymorphism is associated with a lower risk of developing cleft palate or cleft lip in Iranian patients. clet palatot cleft lip PMID: 24613087
  • precursor of the hormone Irisin (FNCD5) were abundantly expressed in all three fat depots, along with fibroblast growth factors (FGF) FGF1, FGF7 and FGF10, whereas, FGF19 and FGF21 were undetectable. PMID: 23949615
  • Nucleolin-FGF1 interaction is critical for the intranuclear phosphorylation of FGF1 by PKCdelta and thereby the regulation of nuclear export of FGF1. PMID: 24595027
  • the genotype distribution of rs34011 within fibroblast growth factor 1 was significantly different between Alzheimer's disease and control group PMID: 24464990
  • discovery of unexpected, neomorphic insulin-sensitizing action for exogenous non-mitogenic human FGF1 with therapeutic potential for the treatment of insulin resistance and type 2 diabetes PMID: 25043058
  • By introducing two stabilizing mutations in the C-terminal part of the protein, obtained are variants highly resistant proteolytically with prolonged half-life and enhanced mitogenic activity. PMID: 24304385
  • Data suggest that the enhanced cell growth was likely due to the electrical stimulation up-regulated secretion of FGF-1 and FGF-2. PMID: 23990967
  • Both FGF1 and ERBB2 significantly influenced overall survival in breast cancer patients, especially among women with low levels of Native American ancestry. PMID: 23912956
  • We demonstrate that mesenchymal stromal cells increase FGF-1 secretion on co-culture with Human primary chondrocytes, which, in turn, is responsible for increased Human primary chondrocytes proliferation in pellet co-cultures. PMID: 23557133
  • FGF1 polymorphism is associated with breast cancer. PMID: 23143756
  • R50E suppresses angiogenesis induced by FGF1 or FGF2, and thereby indirectly suppresses tumorigenesis, in addition to its possible direct effect on tumor cell proliferation in vivo PMID: 23469107
  • studied the functional consequences of HSulf-2 activity on fibroblast growth factor (FGF)-induced mitogenesis and found that the enzyme could differentially regulate FGF1 and FGF2 activities PMID: 23457216
  • The expression of FGF-1 in the in vitro fertilization (IVF) implantation failure group is less than in the fertile group, which suggests that growth factors such as FGF-1 are important maternal factors effecting implantation PMID: 23426545
  • forms of FGF-1 that enhance thermostability or eliminate buried reactive thiols demonstrate a shorter distribution half-life, a longer elimination half-life, and a longer mean residence time (MRT) in comparison to wild-type FGF-1 PMID: 23133616
  • The folding transition state of FGF-1 is shown to be highly polarized, with the majority of turns adopting either native-like or denatured-like structure in the folding transition state. PMID: 23047594
  • LRRC59 facilitates transport of cytosolic FGF1 through nuclear pores by interaction with Kpns and movement of LRRC59 along the ER and NE membranes PMID: 22321063
  • [review] In this review, the authors discuss recent and ongoing research into the role of fibroblast growth factor and transforming growth factor-beta in the etiopathogenesis of craniosynostosis. PMID: 21806346
  • Plasticity in interactions of fibroblast growth factor 1 (FGF1) N terminus with FGF receptors underlies promiscuity of FGF1. PMID: 22057274
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed