Recombinant Human FANCM Protein

Beta LifeScience SKU/CAT #: BLA-3490P
Recombinant Human FANCM Protein

Recombinant Human FANCM Protein

Beta LifeScience SKU/CAT #: BLA-3490P
Catalog No.: BLA-3490P

Product Overview

Host Species Human
Accession Q8IYD8-2
Synonym ATP-dependent RNA helicase FANCM FAAP250 Fanconi anemia group M protein fanconi anemia-associated polypeptide of 250 kDa KIAA1596 Protein Hef ortholog
Description Recombinant Human FANCM Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MSGRQRTLFQTWGSSISRSSGTPGCSSGTERPQSPGSSKAPLPAAAEAQL ESDDDVLLVAAYEAERQLCLENGGFCTSAGALWIYPTNCPVRDYQLHISR AALFCNTLVCLPTGLGKTFIAAVVMYNFYRWFPSGKVVFMAPTKPLVTQQ IEACYQVMGIPQSHMAEMTGSTQASTRKEIWCSKRVLFLTPQVMVNDLSR GACPAAEIKCLVIDEAHKALGNYAYCQVVRELVKYTNHFRILALSATPGS DIKAVQQVITNLLIGQIELRSEDSPDILTYSHERKVEKLIVPLGEELAAI QKTYIQILESFARSLIQRNVLMRRDIPNLTKYQIILARDQFRKNPSPNIV GIQQGIIEGEFAICISLYHGYELLQQMGMRSLYFFLCGIMDGTKGMTRSK NELGRNEDFMKLYNHLECMFARTRSTSANGISAIQQGDKNKKFVYSHPKL KKLEEVVIEHFKSWNAENTTEKKRDETRVMIFSSFRDSVQEIAEMLSQHQ PIIRVMTFVGHASGKSTKGFTQKEQLEVVKQFRDGGYNTLVSTCVGEEGL DIGEVDLIICFDSQKSPIRLVQRMGRTGRKRQGRIVIILSEGREERIYNQ SQSNKRSIYKAISSNRQVLHFYQRSPRMVPDGINPKLHKMFITHGVYEPE KPSRNLQRKSSIFSYRDGK
Molecular Weight 102 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed