Recombinant Human Elafin (PI3) Protein (His-SUMO)

Name: Recombinant Human Elafin (PI3) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-02894P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Elafin (PI3) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P19957
Target Symbol	PI3
Synonyms	Cementoin; ELAF_HUMAN; Elafin; Elafin/Skalp; Elastase Specific Inhibitor; Elastase-specific inhibitor; ES 1; ESI; Peptidase inhibitor 3; Peptidase inhibitor 3; skin derived; PI 3; PI-3; PI3; Pre elafin; Protease inhibitor 3 skin derived ; Protease inhibitor 3; skin derived (SKALP); Protease inhibitor WAP3; SKALP; Skin derived Anti leukoproteinase; Skin-derived antileukoproteinase; Trappin 2; WAP four disulfide core domain 14; WAP four disulfide core domain protein 14; WAP four-disulfide core domain protein 14; WAP3; WFDC14
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Expression Range	61-117aa
Protein Length	Full Length of Mature Protein
Mol. Weight	22.0kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis. Has been shown to inhibit the alpha-4-beta-2/CHRNA2-CHRNB2 nicotinic acetylcholine receptor and to produce a weak inhibition on Kv11.1/KCNH2/ERG1 and on the transient receptor potential cation channel subfamily V member 1 (TRPV1).
Subcellular Location	Secreted.
Database References	HGNC: 8947 OMIM: 182257 KEGG: hsa:5266 STRING: 9606.ENSP00000243924 UniGene: PMID: 29084078 Plasma Neutrophil Elastase and Elafin as Prognostic Biomarker for Acute Respiratory Distress Syndrome PMID: 28187039 UV phototoxicity-induced pre-elafin inside keratinocytes prior to cornified envelope formation could be involved in UV-induced keratinocyte apoptosis via cystatin-A downregulation resulting in pro-caspase-3 activation. PMID: 28119996 Recombinant human elafin promotes alveologenesis in newborn mice exposed to chronic hyperoxia PMID: 28802561 significantly higher expression in preterm prelabor ruptured fetal membranes than in membranes from term birth PMID: 27580179 Our study revealed that high elafin levels identified in smoking- and asthma-related microarray data sets and an epidemiologic study significantly reduced the risk of asthma. PMID: 26932165 The expression of elafin in fallopian tubes of ectopic pregnancies is reduced. PMID: 25356943 The elevations in cervical elafin and SLPI expression in the women with preterm delivery might reflect the local response to the pathogen invasion into the cervix preceding preterm labor. PMID: 25559229 PI3 expression was downregulated in 24% of DCIS and 83% of invasive breast tumors. PI3 was also downregulated in 33% of ovarian cystadenomas, 43% of borderline ovarian tumors, and 86% of invasive ovarian carcinomas. PMID: 25551582 The imbalance between neutrophil elastase and its inhibitors, such as elafin, presents an important therapeutic target in breast cancer. PMID: 25195861 Higher urinary elafin levels are associated with an increased risk of micro- and macroalbuminuria, acute kidney injury and chronic kidney disease, and death after hematopoietic stem cell transplantation. PMID: 25388519 cutaneous elafin does not seem to discriminate acute graft-versus-host disease from drug hypersensitivity rash lesions, but there may be an association between cutaneous elafin expression and poor prognosis for patients with cutaneous GVHD PMID: 25405322 Data indicate that elafin overexpression is associated with poor overall survival. PMID: 24469047 Low expression of elafin gene correlated with significantly reduced time to relapse, and when combined with high expression of elastase gene was associated with decreased survival in breast cancer patients PMID: 23320734 Elafin has important roles in normal homoeostasis and at sites of inflammation. These roles include antiprotease and antimicrobial activity. PMID: 19906197 Results confirm the association between SNP rs2664581 and enhanced risk of developing acute respiratory distress syndrome. PMID: 24617927 Tubal epithelium from women with hydrosalpinx has lower levels of elafin expression. PMID: 23885101 Elafin expression in the small intestinal epithelium was lower in patients with active celiac disease compared with control patients. In vitro, elafin significantly slowed the kinetics of the deamidation of the 33-mer peptide to its more immunogenic form. PMID: 24710505 Production of HBD2 and elafin by vaginal epithelial cells is sensitive to E, suggesting that innate immune protection varies in the vagina across the menstrual cycle. PMID: 23398087 Elafin expression may establish the diagnosis of pre-engraftment syndrome and graft versus host disease. PMID: 23866880 Trappin-2 and elafin significantly reduce HSV-2 viral attachment to, and replication in genital epithelial cells. PMID: 23637403 The N-terminus of elafin is critical for intranuclear localization and anti-HIV-1 activity. PMID: 23300756 Studies indicate that Trappin-2/Elafin possessing anti-microbial properties against different classes of pathogens including viruses, fungi and bacteria. PMID: 22634606 The results suggest that decreased expression of elastin and LOX and increased expression of elafin in the cardinal ligaments may contribute to pelvic organ prolapse. PMID: 19087518 The endometrium of women with hydrosalpinx has an increased number of neutrophils and lower expression of elafin, an elastase inhibitor and natural antimicrobial molecule. PMID: 21392745 these results collectively suggest that, in melanoma cells, Foxa2 expression is silenced and therefore elafin is maintained unexpressed to facilitate cell proliferation in the disease melanoma. PMID: 21466784 ability to modulate the expression of some P.aeruginosa virulence factors PMID: 20932308 These results suggest that elafin can maintain airway epithelium integrity by protecting airway epithelial cells and enhancing the anti-inflammatory capability of airway. PMID: 19823954 increased production at the secretory phase of the menstrual cycle relative to the proliferative phase PMID: 19824918 Elafin has a role in graft-versus-host disease of the skin PMID: 20371463 Elafin may serve as a determinant of poor survival in serous ovarian carcinomas PMID: 20126474 Overexpression of elafin in epithelial cells attenuated the damage of Pseudomonas aeruginosa biofilm. PMID: 19420899 Elafin is a component of cervicovaginal secretions in pregnancy, and levels are diminished in bacterial vaginosis. PMID: 19723838 Synthesized locally at mucosal sites. Efficiently inhibit target enzymes released into interstitium. Might be important in controlling excessive neutrophil elastase release in chronic obstructive pulmonary disease and cystic fibrosis. (review) PMID: 11667971 regulation of the elafin gene is dependent on chromatin structure in keratinocytes PMID: 12542536 results indicate that elafin may have a dual function, promoting up-regulation of local lung innate immunity while simultaneously down-regulating potentially unwanted systemic inflammatory responses in the circulation PMID: 12819058 elafin regulates proteolytic enzymes during menstruation and contributes to the innate defense against uterine infection PMID: 12970320 Serine elastase inhibition (elafin overexpression) appears to suppress inflammation, cardiac dilatation, and dysfunction after myocardial infarct. PMID: 14693682 Gene augmentation of human elafin suggests a novel and extended anti-inflammatory role for this human neutrophil elastase inhibitor working as an effector of innate immunity to protect tissues against maladaptive inflammatory responses. PMID: 15034071 The differential biological activity of elafin in different conditions suggests a role for this molecule in either LPS detoxification or activation of innate immune responses, depending on the external cellular environment. PMID: 15668324 Oxidized elafin poorly inhibits the elastolytic activity of leukocyte elastase and proteinase 3. PMID: 16279952 transglutaminase 2-mediated cross-linking of serine protease inhibitors elafin and trappin-2 to neutrophil serine proteinases preserves their inhibitory capacities PMID: 16300411 The pleiotropic molecule elafin has significant potential in modulating antigen-presenting cell numbers and activity, and could be beneficial in mucosal protective strategies. PMID: 16424380 The promoter sequences of PI3 have a high degree of variability. PMID: 16719916 beneficial effects of pre-elafin could be mediated, at least in part, by its ability to increase G-CSF levels in the lung PMID: 16913840 The transglutaminase substrate moiety of elafin plays an important role in anchoring elafin at its proper sites of action during UV-induced aging processes. PMID: 17139263 Levels of mRNA and immunostaining of the antiproteases elafin and SLPI were enhanced strongly in inflamed versus noninflamed UC. Elafin and SLPI may be added to the list of defensin-like peptides with diminished induction in CD versus UC. PMID: 17200145 full antipeptidase activity of pre-elafin is essential to protect against lung tissue lesions PMID: 17489739 This review focuses on recent findings revealing that elafin has many biological functions as diverse as anti-bacterial, anti-fungal, anti-viral, anti-inflammatory and immuno-modulatory functions. PMID: 17964057 We report here that pre-elafin inhibits a secreted peptidase to prevent Pseudomonas aeruginosa growth in vitro. PMID: 18025118

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.