Recombinant Human Collagen Triple Helix Repeat-Containing Protein 1 (CTHRC1) Protein (hFc)

Beta LifeScience SKU/CAT #: BLC-01255P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Collagen Triple Helix Repeat-Containing Protein 1 (CTHRC1) Protein (hFc)

Beta LifeScience SKU/CAT #: BLC-01255P
Save $1,270
/
Size

Product Overview

Description Recombinant Human Collagen Triple Helix Repeat-Containing Protein 1 (CTHRC1) Protein (hFc) is produced by our Mammalian cell expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q96CG8
Target Symbol CTHRC1
Species Homo sapiens (Human)
Expression System Mammalian cell
Tag C-hFC
Target Protein Sequence SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK
Expression Range 31-243aa
Protein Length Full Length of Mature Protein
Mol. Weight 52 kDa
Research Area Cell Migration
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function May act as a negative regulator of collagen matrix deposition.
Subcellular Location Secreted, extracellular space, extracellular matrix.
Database References
Associated Diseases Barrett esophagus (BE)
Tissue Specificity Isoform 1 is expressed in calcified atherosclerotic plaque and chondrocyte-like cells.

Gene Functions References

  1. CTHRC1 serves as a pro-metastatic gene that contributes to NSCLC invasion and metastasis, which are mediated by upregulated MMP7 and MMP9 expression. Targeting CTHRC1 may be beneficial for inhibiting NSCLC metastasis. PMID: 29631554
  2. High Collagen Triple Helix Repeat Containing 1 Expression is associated with Osteosarcoma. PMID: 29970438
  3. E6/E7-p53-POU2F1-CTHRC1 axis promotes cervical cancer cell invasion and metastasis PMID: 28303973
  4. IL-1beta and CTHRC1 are upregulated in patients with Osteoarthritis. PMID: 29393342
  5. CTHRC1 interacts with integrin beta3 and accelerates the FAK phosphorylation to promote ovarian cancer cell adhesion, migration and invasion in vitro and in vivo. PMID: 29021002
  6. CTHRC1 plays a pivotal role in a great many fields, including increases bone mass, prevents myelination, reverses collagen synthesis in keloid fibroblasts, and increases fibroblast-like synoviocytes migration speed and abundant production of arthritic pannus in rheumatoid arthritis PMID: 28901303
  7. CTHRC1, negatively regulated by miR-30c, promoted cell proliferation, invasion and migration and suppressed cell apoptosis in breast cancer, which might be by activating GSK-3beta/beta-catenin signaling and inhibiting Bax/Caspase-9/Caspase-3 signaling respectively. PMID: 28697793
  8. Our data suggest that CTHRC1 may act as an oncogenic driver in progression and metastasis of ESCC, and may serve as a potential biomarker for prognosis and personalized therapy. PMID: 28645305
  9. The negative and sensitivity-predictive values of CTHRC1 staining were excellent for both lymph node and peritoneal metastases. PMID: 27870703
  10. High CTHRC1 expression is associated with metastatic melanomas. PMID: 26918341
  11. CTHRC1 was established as a novel marker of activated synoviocytes in murine experimental arthritis and rheumatoid arthritis PMID: 27430622
  12. ANOS1 and its co-expression partner, CTHRC1, promote the development and metastasis of colorectal cancer. PMID: 28854193
  13. Expression of CTHRC1 was significantly higher in Wilms' tumor compared to the expression in the adjacent non-cancerous tissues. High tumor expression of CTHRC1 was associated with tumor size, clinical stage, histopathological type, and vascular invasion/metastasis. Patients with high CTHRC1 expression also exhibited a shorter survival. PMID: 27230801
  14. CTHRC1 expression is significantly upregulated in human masticatory mucosa during wound healing. PMID: 28005267
  15. CTHRC1 downregulation inhibited proliferation. PMID: 28281968
  16. The knockdown of CTHRC1 exerts inhibitory effects on the proliferation and migration ability of glioblastoma cells. PMID: 28277194
  17. CTHRC1 may play a role in the progression of ovarian cancer. PMID: 27779718
  18. this study shows that the serum CTHRC1 level was significantly higher in the influenza A virus infection patients than in the healthy individuals; the influenza A virus non-structural protein NS1 upregulates the expression of CTHRC1 protein PMID: 27718266
  19. Gene expression levels of three randomly selected DEGs, VCAN, COL5A1 and KCNJ16, were examined using RT-PCR in 10 ATC samples.. angiogenesis was activated by the high expression of CTHRC1, VCAN and POSTN, providing necessary nutrition for tumor cells PMID: 27599582
  20. increased CTHRC1 expression is associated with advanced TNM stage, increased LN metastasis and tumor size, and decreased OS and DFS, indicating that CTHRC1 may be a biomarker for prognosis of cancer patients PMID: 27323076
  21. High CTHRC1 expression is associated with Osteosarcoma. PMID: 27043295
  22. Authors showed that ectopic transfection of CTHRC1 in EOC cells up-regulated the expression of EMT markers such as N-cadherin and vimentin, and EMT-associated transcriptional factor Snail. PMID: 26452130
  23. CTHRC1 is secreted both by colorectal epithelia cells and stromal fibroblasts. CTHRC1 overexpression promotes colorectal cancer cell migration, invasion and proliferation in vitro. PMID: 26722469
  24. determined the mRNA and protein expression of CTHRC1 in oral squamous cell carcinoma and evaluated the clinical and prognostic impact of CTHRC1 overexpression PMID: 26664254
  25. CTHRC1 has a novel role in viral infection. PMID: 26180054
  26. HBV facilitates HCC development through activating the oncoprotein CTHRC1. PMID: 25263696
  27. CTHRC1 was overexpressed in human non-small cell lung cancer tissues and non-small cell lung cancer cell lines at the protein and mRNA level. PMID: 25238260
  28. let-7b may directly target Cthrc1 and function as a tumor suppressor gene in gastric cancer. PMID: 25510669
  29. CTHRC1 acts as a prognostic factor and promotes invasiveness of gastrointestinal stromal tumors by activating Wnt/PCP-Rho signaling. PMID: 24726140
  30. Cthrc1 overexpression was associated with non-small cell lung cancers. PMID: 25139095
  31. Cthrc1 is a pituitary hormone with significantly elevated levels in subjects carrying variant alleles of the melanocortin-1 receptor as wells as in patients with inflammatory conditions. PMID: 24945147
  32. CTHRC1 has the potential to be a new biomarker for the aggressive hepatocellular carcinoma PMID: 24841500
  33. CTHRC1 expression is elevated in human colon cancer cell lines and clinical specimens, and promotes cancer cell invasivity through ERK-dependent induction of MMP9 expression. PMID: 24504172
  34. Studied CTHRC1 expression in human breast cancer tissue. A significant increase of CTHRC1 mRNA expression was seen in breast cancer tissue compared to the normal tissue from the same patients using RT-PCR and real-time PCR. PMID: 23658133
  35. Overexpression of CTHRC1 in hepatocellular carcinoma promotes tumor invasion and predicts poor prognosis. PMID: 23922981
  36. Rs35500845 in the CTHRC1 gene was associated with Paget's disease of bone in the French-Canadian population. PMID: 24370779
  37. high Cthrc1 expression was an independent prognostic factor for both overall survival and disease-free survival of patients with gastric carcinoma PMID: 24746208
  38. Data suggest that in oral squamous cell carcinoma (OSCC), dysregulation of canonical Wnt signaling and DPAGT1-dependent N-glycosylation induces CTHRC1, thereby driving OSCC cell migration and tumor spread. PMID: 23703614
  39. this is the first demonstration of Cthrc1 as a marker of the severity of the disease progression in the dystrophic muscles. PMID: 23274062
  40. the results of our study suggest that increased expression of CTHRC1 is associated with peritoneal carcinomatosis in Colorectal cancer patients PMID: 23359115
  41. CTHRC1 has a role in pancreatic cancer progression and metastasis by regulating migration and adhesion activities of cancer cells. PMID: 23222813
  42. Data indicate that the upregulated expression of collagen triple helix repeat containing 1 (CTHRC1) in gastric carcinogenesis contributes to tumor cell invasion and metastasis. PMID: 22590977
  43. Three major genes, MSR1, ASCC1, and CTHRC1 were associated with Barrett esophagus/esophageal adenocarcinoma PMID: 21791690
  44. CTHRC1 is transiently expressed in the arterial wall in response to injury where it may contribute to vascular remodeling by limiting collagen matrix deposition and promoting cell migration. PMID: 15618538
  45. Aberrant expression of CTHRC1 is widely present in human solid cancers and seems to be associated with cancer tissue invasion and metastasis. PMID: 16778098
  46. Intracellular localization of Cthrc1 characterizes differentiated smooth muscle. PMID: 18467647

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

More from Beta LifeScience's Promotion
Western Blot | Positive WB detected in: MCF-7 whole cell lysate, A549 whole cell lysate, Mouse thymus | All lanes: ACAA2 antibody at 1:2000 | Secondary | Goat polyclonal to rabbit IgG at 1/50000 dilution | Predicted band size: 42 kDa | Observed band size: 42 kDa
IHC image of ACAA2 Recombinant Monoclonal Antibody diluted at 1:100 and staining in paraffin-embedded human colon cancer performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a Goat anti-rabbit polymer IgG labeled by HRP and visualized using 0.05% DAB.
ACAA2 Recombinant Monoclonal Antibody
CAT#: BLC-06609A
IHC image of the antibody diluted at 1:100 and staining in paraffin-embedded human breast cancer performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a Goat anti-rabbit polymer IgG labeled by HRP and visualized using 0.07% DAB.
IHC image of Acetyl-HIST1H3A(K18) Recombinant Monoclonal Antibody diluted at 1:100 and staining in paraffin-embedded human gastric cancer performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a Goat anti-rabbit polymer IgG labeled by HRP and visualized using 0.07% DAB.
Acetyl-HIST1H3A(K18) Recombinant Monoclonal Antibody
CAT#: BLC-06595A
Western BlotPositive WB detected in:293 whole cell lysate, HepG2 whole cell lysate, Mouse kidney tissueAll lanes:Acetyl-Histone H4 (K16) antibody at 1.65μg/mlSecondaryGoat polyclonal to rabbit IgG at 1/50000 dilutionPredicted band size: 11 KDaObserved band size: 11 KDa
Immunocytochemistry analysis of Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody diluted at 1:100 and staining in Hela cells performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4℃ overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody
CAT#: BLC-06518A
Western BlotPositive WB detected in:293 whole cell lysate, HepG2 whole cell lysate, Mouse kidney tissueAll lanes:Acetyl-Histone H4 (K16) antibody at 1.65μg/mlSecondaryGoat polyclonal to rabbit IgG at 1/50000 dilutionPredicted band size: 11 KDaObserved band size: 11 KDa
Immunocytochemistry analysis of Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody diluted at 1:100 and staining in Hela cells performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4℃ overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody
CAT#: BLC-06519A
Western BlotPositive WB detected in:293 whole cell lysate, HepG2 whole cell lysate, Mouse kidney tissueAll lanes:Acetyl-Histone H4 (K16) antibody at 1.65μg/mlSecondaryGoat polyclonal to rabbit IgG at 1/50000 dilutionPredicted band size: 11 KDaObserved band size: 11 KDa
Immunocytochemistry analysis of Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody diluted at 1:100 and staining in Hela cells performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4℃ overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody
CAT#: BLC-06520A
Western Blot | Positive WB detected in Hela whole cell lysate, MCF-7 whole cell lysate, 293 whole cell lysate, HepG2 whole cell lysate | All lanes Acetyl-Histone H4 (K5) antibody at 1.05μg/ml | Secondary | Goat polyclonal to rabbit IgG at 1/50000 dilution | Predicted band size: 11 KDa | Observed band size: 11 KDa
Immunocytochemistry analysis of Acetyl-Histone H4 (K5) Recombinant Monoclonal Antibody diluted at 1:100 and staining in Hela cells performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4℃ overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Acetyl-Histone H4 (K5) Recombinant Monoclonal Antibody
CAT#: BLC-06516A
Recently viewed