Recombinant Human Catechol O-Methyltransferase (COMT) Protein (His)

Name: Recombinant Human Catechol O-Methyltransferase (COMT) Protein (His)
Brand: Beta LifeScience
SKU: BLC-02887P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Catechol O-Methyltransferase (COMT) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P21964
Target Symbol	COMT
Synonyms	Catechol O methyltransferase; Catechol O-methyltransferase; COMT; COMT_HUMAN; EC 2.1.1.6
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	GDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Expression Range	52-271aa
Protein Length	Partial
Mol. Weight	28.3kDa
Research Area	Metabolism
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
Subcellular Location	[Isoform Soluble]: Cytoplasm.; [Isoform Membrane-bound]: Cell membrane; Single-pass type II membrane protein; Extracellular side.
Protein Families	Class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family
Database References	HGNC: 2228 OMIM: 103780 KEGG: hsa:1312 STRING: 9606.ENSP00000354511 UniGene: PMID: 29634613 These findings suggest that the association between COMT polymorphisms and cognitive functioning could be, at least in part, due to their association with varying levels of S-COMT. This is important as, unlike MB-COMT, the substrates targeted by S-COMT are likely to be intra-cellular rather than, like dopamine, located mainly in the synaptic vesicles or the extra-cellular space. PMID: 30218069 The COMT gene rs165599 SNP does not appear to be a single-risk factor for schizophrenia. PMID: 30165727 An interaction between the COMT genotype and childhood adversity, affects executive function in adolescents. PMID: 29222971 that the presence of one or two Met alleles of the COMT Val(158/108)Met might act as a protective variant in working memory tasks in combat exposed veterans with posttraumatic stress disorder PMID: 29248614 Association between COMT Val158Met polymorphisms with antisaccade task performance in schizophrenic patients. PMID: 29429137 variant and temporomandibular disorders may contribute to individual variation in electric and cold pulp sensitivity PMID: 29550002 T-77C and Arg399Gln polymorphisms of the XRCC1 gene, as well as the 186C>T and Val158Met polymorphisms of the COMT gene, increased the risk of lung cancer in non-smoking women. PMID: 30109864 COMT-GG and NRG1-AA genotypes aid the transcranial direct current stimulation-induced improvement in auditory verbal hallucinations in schizophrenia patients. PMID: 29559020 In those who had used cannabis before 20 years of age, COMT Val158Met polymorphism had a trend level effect on age of onset of psychosis (median age of onset of psychosis : Val/Val < Val/Met < Met/Met 19.37, 20.95, 21.24 years, respectively; log-rank test p = .051). PMID: 29201551 findings support the hypothesis that G x E interactions underlie associations of COMT val158met with fear inhibition deficits PMID: 28833952 COMT gene moderates the relation between maternal history of maltreatment and infant emotion regulation. PMID: 28803562 Its single-nucleotide polymorphisms involves in dopaminergic metabolism and motor and cognitive function in older adults. PMID: 29525179 COMT DNA methylation level is affected by the severity of the clinical symptoms of schizophrenia and might also be influenced by pharmacological treatment. PMID: 29160620 The present study showed that females with middle dopamine availability (valA/valB or met/met) and evidence of emotional problems in adolescence were more likely to have affective symptoms at age 53. PMID: 29331705 findings suggest that Val/Val homozygous individuals for catachol-O-methyltransferase (COMT) may be more flexible regarding self-attribution/body ownership and that biological factors may contribute to reduced awareness regarding the distinction between self and others. PMID: 28251370 Cloninger's (1987) hypothesis about negative relationship between novelty seeking and dopamine was confirmed on allele level, because higher novelty seeking was found in Val allele carriers comparing to Met/Met genotype carriers. PMID: 29546858 Study provides evidence for an epistatic interaction between ZNF804A rs1344706 and COMT rs4680 on the grey matter volume of the left dorsolateral prefrontal cortex, which may improve our understanding on the biological mechanism underlying the genome-wide supported variant ZNF804 rs1344706 of schizophrenia on the prefrontal anatomy. PMID: 28078547 Logistic regressions with interaction terms (adjusted for sex and age) revealed that comt rs4680 interacted with total childhood adversity, emotional abuse and physical abuse in predicting panic disorder. PMID: 29574383 No significant difference was observed in the RNA levels of CYP1A1 and SULT1A1 between the two groups. The frequency of expression of the CYP17 T/C variant tended to be higher and the A allele of COMT polymorphism together with down-regulation of its mRNA expression may be more frequent in Chinese women with idiopathic POI PMID: 28887105 Individuals carrying Val/Val of COMT seem to be more sensitive to the synergistic effect of environmental factors acting early in neurodevelopment. PMID: 28262436 childhood urbanicity and variation in dopamine genes COMT, DRD1 and DRD2 alters adult prefrontal function as measured by fMRI PMID: 29634738 None of the polymorphisms studied showed a reliable association with response inhibition performance. The methodological and theoretical implications of these findings are discussed. PMID: 29155230 the association between the COMT Val158Met and ZDHHC8 rs175174 single nucleotide polymorphism and the susceptibility to schizophrenia through a case-control study involving a population from the North Region of Brazil, was investigated. PMID: 28562378 Results revealed a sex-specific effect of COMT on corpus callosum (CC): in males only, Val homozygotes had significantly higher fractional anisotropy (FA) compared to Met-carriers. Volume-of-interest analysis showed a genotype by sex interaction on FA in genu and rostral midbody of CC, whereby Val males demonstrated higher FA than Met females. PMID: 28948081 No association between self-reported non-recovery or pain levels and COMT haplotypes in in a Northern European patients with acute whiplash injuries could be detected. PMID: 29195501 The aim of this study was to investigate the effects of the interaction between the CYP 2A6 and COMT genes on smoking behavior in young Taiwanese men. The odds ratio for starting smoking was significantly lower in subjects carrying a CYP2A6 low activity/variant COMT rs4680 genotype than in those possessing a CYP2A6 wild-type/variant COMT rs4680 genotype (0.44, 95% confidence interval = 0.19-0.98, P = 0.043). PMID: 28472995 Results show no association between TPMT or COMT single-nucleotide polymorphisms and cisplatin-induced ototoxicity. PMID: 28445188 Study applied graph theory analysis on resting-state fMRI of 120 women selected based on neuroticism score, & genotyped 2 polymorphisms: 5-HTTLPR (S-carriers and L-homozygotes) and COMT (rs4680-rs165599; COMT risk group and COMT non-risk group). The COMT polymorphism moderated the association between neuroticism and functional network organization. PMID: 27743374 The purpose of the current study is to test the interaction between prenatal maternal smoking and COMT Val(158)Met in conduct problems and crime in the 1993 Pelotas Birth Cohort Study. PMID: 27426045 We found no modulation of saccade parameters by COMT genotype in a visually guided control task. PMID: 27793591 Study used a mediation analysis to identify a gene-anatomy-cognition pathway to explain how COMT Val158Met polymorphism affects interference resolution capacity via modulating the gray matter volume of the left lateral frontal pole in healthy male subjects. PMID: 27664968 Findings do not suggest an additional impairment from comorbid alcohol and substance use disorders (AUDs/SUDs) on facial emotion recognition among subjects with schizophrenia, whilst COMT Val158Met, though based on a limited sample, might have a role just among those without AUDs/SUDs. PMID: 28913946 In a study of the genetic association between polymorphisms in the DAT1, SERT, COMT and BDNF genes and attention deficit and hyperactive disorder, transmission disequilibrium test analysis showed that no individual allele of any variant studied has a preferential transmission PMID: 29122229 There is an association between COMT Val108/158Met and schizophrenia in the general population (Review and Meta-analysis). PMID: 27020768 Val/Met polymorphism as a candidate gene variant to assess associations with subjective dimensions of hypnosis PMID: 28836919 A significant difference in the genotype distribution of the COMT A158G polymorphism was demonstrated, favoring the low activity genotype in patients with Polyneuropathy compared to both controls and patients without Polyneuropathy. PMID: 28759974 The present results indicate that rs4633 and rs4680 catechol-O-methyltransferase polymorphisms influence cerebrospinal fluid dopamine concentrations and methamphetamine toxicity in MA abusers. PMID: 27987399 The COMT variant (rs4680) was associated with poor appetite/undereating in an adolescent population. PMID: 28694222 The findings showed that a group of patients with a GG single nucleotide polymorphism (SNP) rs4680 in COMT required a significantly higher dose of morphine than a non-GG group. PMID: 28985716 For case-only studies, a significant interaction was found between cannabis use and COMTVal158Met, with an OR of 1.45 (95% Confidence Interval = 1.05-2.00; Met/Met as the risk genotype (Meta-Analysis) PMID: 29444152 To determine the frequency of COMT Val158Met polymorphism. PMID: 28968204 Analyses suggest that COMT val158met polymorphism moderates the influence of early life stress on preschool-age symptoms of anxiety. PMID: 28859863 Our study demonstrated nonlinear modulation of the interaction between COMT and depression on brain function. These findings expand our understanding of the COMT effect underlying the pathophysiology of MDD. PMID: 28728097 there is a relationship between Val158Met COMT and certain social cognitive deficits in patients with schizophrenia PMID: 28856668 meta-analysis suggested that the COMT Val158Met polymorphism was not associated with migraine risk (Meta-Analysis) PMID: 27154995 These findings support the hypothesis of a broad effect of the Val158Met polymorphism in the COMT gene on several dimensions of behavior and neuropsychiatric symptoms. PMID: 28235603 It is unlikely that the investigated genetic variants are clinically relevantly associated with depression after diagnosis of cancer. PMID: 28590587 In our study, statistical analysis has showed that in control group Val/Met COMT genotype was significantly higher compared with the obesity group PMID: 28629779 COMT 158G/A (COMT Val158Met) polymorphism was associated with suicide susceptibility only in females. PMID: 28676589

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.