Recombinant Human C-X-C Chemokine Receptor Type 2 (CXCR2) Protein (His-SUMO)

Name: Recombinant Human C-X-C Chemokine Receptor Type 2 (CXCR2) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-04129P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human C-X-C Chemokine Receptor Type 2 (CXCR2) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P25025
Target Symbol	CXCR2
Synonyms	C-X-C chemokine receptor type 2; CD 182; CD182; CD182 antigen; CDw128b; Chemokine (CXC) receptor 2; CMKAR2; CXC-R2; CXCR 2; CXCR-2; CXCR2; CXCR2_HUMAN; GRO/MGSA receptor; High affinity interleukin-8 receptor B; IL 8 receptor type 2; IL 8R B; IL-8 receptor type 2; IL-8R B; IL8 RB; IL8 receptor type 2; IL8R B; IL8R2; IL8RA; Interleukin 8 Receptor B; Interleukin 8 receptor; beta; Interleukin 8 receptor; type 2
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE
Expression Range	1-40aa
Protein Length	Partial
Mol. Weight	20.6kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Protein Families	G-protein coupled receptor 1 family
Database References	HGNC: 6027 OMIM: 146928 KEGG: hsa:3579 STRING: 9606.ENSP00000319635 UniGene: PMID: 29948377 CXCR2 protein expression was up-regulated in both the epileptic foci of temporal lobe epilepsy patients and in the pilocarpine mouse model. The CXCR2 selective antagonist SB225002, which was i.p. administered during the spontaneous recurrent seizures (SRSs) latency window preceding SRS onset, suppressed SRSs activity during the chronic period of epilepsy. PMID: 28705496 results indicated that the CXCR2 +1208 CT genotype is less frequent in advanced stages of prostate cancer, suggesting that this chemokine receptor plays a role in the pathogenesis of this disease PMID: 28668699 CXCR2 expression is a promoter of CRC local as well as distant metastasis and unfavorably associated with CRC patients' prognosis. Moreover, CXCR2 can stratify high-risk patients especially in normally early stage low-risk CRC patients. PMID: 28415702 PADI4 contributes to gastric tumorigenesis by upregulating CXCR2, KRT14 and TNF-alpha expression. PMID: 27556695 KHSV miR-K3 activates the GRK2/CXCR2/AKT axis inducing KSHV-induced angiogenesis and promoting KSHV latency. PMID: 27058419 CXCR2 mRNA and protein expression levels were significantly decreased in preeclamptic placentas than normal control. The invasive abilities of the two trophoblast cell lines were significantly inhibited when CXCR2 was silenced, but that CXCR2 overexpression promoted trophoblast cells invasion. PMID: 27324095 CXCR2 promotes breast cancer metastasis and chemoresistance via suppressing AKT1 and activating COX2. PMID: 28964785 we conclude that CXCR2 is required for the recruitment of TANs, which in turn can suppress antitumor T-cell responses. We showed that CXCR2 ligands, particularly CXCL5, are elevated in both human and mouse PDA. PMID: 27737879 this study shows that neutrophil expression levels of CVCR2 are decreased in septic patients PMID: 27016001 CXCR4 and CXCR2 were highly expressed in a high invasive gastric cancer cell model and in gastric cancer tissues; crosstalk between CXCR4 and CXCR2 contributed to EMT, migration and invasion of gastric cancer. PMID: 28481874 A unique viral protein, vCXCL1, which targets three chemokine receptors: CXCR1 and CXCR2 expressed on neutrophils and CXCR1 and CX3CR1 expressed on Natural killer cells. PMID: 27160907 The expressions of CXCL1 in cancer cells and CXCR2 in stromal cells are useful prognostic factors for gastric cancer patients PMID: 28575019 CXCR2 preferentially supports the maintenance of human pluripotent stem cell characteristics as well as facilitates ectodermal differentiation after the commitment to differentiation, and the mechanism might be associated with mTOR, beta-catenin, and hTERT activities. PMID: 27188501 Our result showed that CXCR2 expression was correlated with high grade (P = 0.024), advanced stage (P = 0.029) and metastasis (P = 0.018). The log-rank test revealed that high CXCR2 and CXCR3 expressions are related to poorer overall survival (P < 0.001; P < 0.001). PMID: 27273823 These data demonstrate that the CXCR2 network and CXCL4 play a role in the maintenance of normal HSC/HPC cell fates, including survival and self-renewal. PMID: 27222476 CXCR1 and CXCR2 regulate hepatocyte exosome release. The mechanism utilized by CXCR1 remains elusive, but CXCR2 appears to modulate Nsm activity and resultant production of ceramide to control exosome release. CXCR1 is required for packaging of enzymes into exosomes that mediate their hepatocyte proliferative effect. PMID: 27551720 TNF-alpha augments CXCR2 and CXCR3 to promote the progression of renal cell carcinoma leading to a poor prognosis. PMID: 27297979 Data indicate that the crystal structure of PDZ-RhoGEF PDZ domain in complex with the CXC chemokine receptor 2 (CXCR2) C-terminal PDZ binding motif. PMID: 28179147 Treatment with 1,25D3 increased poly(I:C)-induced IL-8 mRNA and protein expression after 2 to 6 hours. However, when cells were pretreated with 1,25D3 for 24 hours, 1,25D3 decreased cytokine expression PMID: 27196318 we identified novel pathways associated with GPI-AP- granulocytes by RNA-seq and validated higher CXCR2 expression in GPI-AP- than GPI-AP+ granulocytes. PMID: 28151558 Results identify the CXCL2/MIF-CXCR2 axis as an important mediator in MDSC recruitment and as predictors in bladder cancer. PMID: 27721403 Study shows that CXCR2 signaling in the myeloid compartment is tumor promoting and required for pancreatic cancer metastasis. PMID: 27265504 The usefulness of CXCR-2 as potential tumor marker of esophageal cancer was studied. PMID: 27906878 this study shows that downregulation of CD182 after stimulation with IL-8 is more pronounced in adults than in neonates, whereas fMLP induces changes in receptor expression that are of the same magnitude in neutrophils from neonates as from adults PMID: 27606963 findings present that miR-940 acts as a pivotal adaptor of CXCR2 and its transcription downregulated CXCR2 expression to decrease HCC invasion and migration in vitro. PMID: 27807540 Our findings suggest that CXCL3 and its receptor CXCR2 are overexpressed in prostate cancer cells, prostate epithelial cells and prostate cancer tissues, which may play multiple roles in prostate cancer progression and metastasis. PMID: 26837773 Data suggest that neutrophil-activating peptide 2 (NAP-2) secreted by NK cells can bind to CXC Chemokine Receptor 2 (CXCR2) on mesenchymal stem cells (MSCs) leading to stimulation of its recruitment. PMID: 27052313 High CXCR2 expression is associated with pancreatic cancer. PMID: 26771140 The results of this study show that the CXCR2 rs1126579 polymorphism is significantly associated with ischemic stroke, both individually and in combination with the genotype and/or alleles of other chemokine genes. PMID: 26648969 These studies provide direct evidence linking the activation of IL8, DNA demethylation and the induction of the OA process with important therapeutic implications therein for patients with this debilitating disease. PMID: 26521741 CXCR2 expression is enriched in human atherosclerotic coronary artery. PMID: 26287498 CXCR2-CXCL1 axis is correlated with neutrophil infiltration and predicts a poor prognosis in hepatocellular carcinoma PMID: 26503598 we found the mRNA level of NF-kappaB and IL-8 was higher in gastric ulcer patients, especially in patients with H.pylori-positive gastric ulcer. PMID: 26060478 Study shows that CXCL5 expression is elevated in positive correlation to bladder cancer grade and promotes cell migration and invasion via binding to its receptor CXCR2. PMID: 26058729 CXCR2 positivity combined with postoperative complications is associated with subsequent tumor recurrence in esophageal cancer. PMID: 26231560 IL-10 rs1800896,CXCR2 rs1126579 and selected clinical features can be used as markers for septic shock development, but not for decreased survival. PMID: 26038959 we investigated the changes in promoter methylation patterns using methylation arrays and observed that the promoters of immunomodulatory factors, COX2 and PTGES, and migration-related factors, CXCR2 and CXCR4, were hypomethylated after 5-aza treatment PMID: 25620445 TLR3 stimulates the differentiation of mesenchymal stromal cells from human tonsils into follicular dendritic cell-like cells and induces chemokine secretion, possibly by recruiting C-X-C chemokine receptor 2-expressing immune cells. PMID: 25794662 Data show that long ncRNAs MALAT1 silencing downregulated the expression of the microRNA miR-22-3p target gene CXCR2 and AKT pathway. PMID: 26364720 Data revealed a critical role of a PDZ-based CXCR2 macromolecular complex in EPC homing and angiogenesis. PMID: 25622052 Our results demonstrated that resistance to anti-proliferative effects of CXCR2 may also arise from feedback increases in MIP-2 secretion. PMID: 25682075 CXCR2 is a potential independent adverse prognostic biomarker for recurrence and survival of patients with non-metastatic ccRCC after nephrectomy. PMID: 26188847 The results showed that H. pylori induced the activation of Jak1/Stat3 and IL-8 production, which was inhibited by a Jak/Stat3 specific inhibitor AG490 in AGS cells in a dose-dependent manner PMID: 25837197 Data indicate that the antibodies bound specifically to CXC chemokine receptor-2 (CXCR2) expressing cells. PMID: 25484047 Data indicate the antibodies recognized distinct epitopes of CXC chemokine receptor-2 (CXCR2). PMID: 25484064 our results reveal that circulating concentrations of IL-8 and IL-12 increase along with important vascular threatening traits as fasting serum glucose and VLDL-c, respectively PMID: 25456886 miR141-CXCL1-CXCR2 signaling-induced Treg recruitment regulates metastases and survival of non-small cell lung cancer. PMID: 25349304 3'UTR SNP modulates CXCR2 expression, signaling, and susceptibility to lung cancer PMID: 25480945 data demonstrate that CXCR2 regulates bone marrow blood vessel repair/regeneration and haematopoietic recovery, and clinically may be a therapeutic target for improving bone marrow transplantation. PMID: 25757087

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.