Recombinant Human BTN3A2 Protein

Name: Recombinant Human BTN3A2 Protein
Brand: Beta LifeScience
SKU: BLA-12462P
Availability: InStock

Collections: Other recombinant proteins, Others immune checkpoint proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P78410
Synonym	BT3.2 BT3.3 BT3A2_HUMAN BTF4 BTN3A 2 BTN3A2 Butyrophilin protein Butyrophilin subfamily 3 member A2 Butyrophilin, subfamily 3, member A2 CD277 FLJ40011
Description	Recombinant Human BTN3A2 Protein was expressed in HEK293. It is a Protein fragment
Source	HEK293
AA Sequence	QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVY ADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQ DGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQW SNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGL EKTASISIADPFFRSAQPWVDHHHHHH
Molecular Weight	25 kDa including tags
Purity	>95% SDS-PAGE.Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. The lyo

Target Details

Target Function	Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells.
Subcellular Location	Cell membrane; Single-pass type I membrane protein.
Protein Families	Immunoglobulin superfamily, BTN/MOG family
Database References	HGNC: 1139 OMIM: 613594 KEGG: hsa:11118 STRING: 9606.ENSP00000348751 UniGene: Hs.376046
Tissue Specificity	Detected in T-cells and natural killer cells.

Gene Functions References

CpG-specific DNA methylation of ADAMTSL2 and BTN3A2 at rheumatoid arthritis diagnosis can serve as a marker of treatment response. PMID: 28447857
BTN3A2 genetic variants have role in gastric carcinogenesis. PMID: 28246015
BTN3A2 rs9104 was strongly associated with genotype 1 hepatitis C infection. PMID: 25928882
Three SNPs in BTN3A2 were associated with schizophrenia, rs12214031, rs9393709 and rs12199613. There was no interaction between these SNPs and HSV-1, CMV or toxoplasma exposure. PMID: 22966150
Results suggest that BT3.2 butyrophilin expression by epithelial cells may modulates the intratumoral infiltration of immune cells. PMID: 22685580
our results identify PRSS16 and BTN3A2, two genes thought to play important roles in regulating the immune response, as potentially novel susceptibility genes for Type I Deabetes. PMID: 19295542

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.