Recombinant Human Bh3-Interacting Domain Death Agonist (BID) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09938P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Bh3-Interacting Domain Death Agonist (BID) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09938P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Bh3-Interacting Domain Death Agonist (BID) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P55957 |
| Target Symbol | BID |
| Synonyms | Apoptic death agonist; Apoptotic death agonist BID; BH3 interacting domain death agonist; BH3 interacting domain death agonist p11; BH3 interacting domain death agonist p13; BH3 interacting domain death agonist p15; BH3-interacting domain death agonist p11; BID; BID isoform ES(1b); BID isoform L(2); BID isoform Si6; BID_HUMAN; Desmocollin type 4; FP497; Human BID coding sequence; MGC15319; MGC42355; p11 BID; p13 BID; p15 BID; p22 BID |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD |
| Expression Range | 1-195aa |
| Protein Length | Full Length |
| Mol. Weight | 38.0kDa |
| Research Area | Apoptosis |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Induces caspases and apoptosis. Counters the protective effect of BCL2.; Induces caspase activation and apoptosis. Allows the release of cytochrome c.; Induces ICE-like proteases and apoptosis.; Induces ICE-like proteases and apoptosis.; Does not induce apoptosis.; Induces ICE-like proteases and apoptosis. |
| Subcellular Location | Cytoplasm. Mitochondrion membrane. Mitochondrion outer membrane.; [BH3-interacting domain death agonist p15]: Mitochondrion membrane.; [BH3-interacting domain death agonist p13]: Mitochondrion membrane.; [Isoform 1]: Cytoplasm.; [Isoform 3]: Cytoplasm.; [Isoform 2]: Mitochondrion membrane. |
| Database References | HGNC: 1050 OMIM: 601997 KEGG: hsa:637 STRING: 9606.ENSP00000318822 UniGene: PMID: 29969781 |
