Recombinant Human Bh3-Interacting Domain Death Agonist (BID) Protein (His-SUMO)

Name: Recombinant Human Bh3-Interacting Domain Death Agonist (BID) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09938P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Bh3-Interacting Domain Death Agonist (BID) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P55957
Target Symbol	BID
Synonyms	Apoptic death agonist; Apoptotic death agonist BID; BH3 interacting domain death agonist; BH3 interacting domain death agonist p11; BH3 interacting domain death agonist p13; BH3 interacting domain death agonist p15; BH3-interacting domain death agonist p11; BID; BID isoform ES(1b); BID isoform L(2); BID isoform Si6; BID_HUMAN; Desmocollin type 4; FP497; Human BID coding sequence; MGC15319; MGC42355; p11 BID; p13 BID; p15 BID; p22 BID
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Expression Range	1-195aa
Protein Length	Full Length
Mol. Weight	38.0kDa
Research Area	Apoptosis
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Induces caspases and apoptosis. Counters the protective effect of BCL2.; Induces caspase activation and apoptosis. Allows the release of cytochrome c.; Induces ICE-like proteases and apoptosis.; Induces ICE-like proteases and apoptosis.; Does not induce apoptosis.; Induces ICE-like proteases and apoptosis.
Subcellular Location	Cytoplasm. Mitochondrion membrane. Mitochondrion outer membrane.; [BH3-interacting domain death agonist p15]: Mitochondrion membrane.; [BH3-interacting domain death agonist p13]: Mitochondrion membrane.; [Isoform 1]: Cytoplasm.; [Isoform 3]: Cytoplasm.; [Isoform 2]: Mitochondrion membrane.
Database References	HGNC: 1050 OMIM: 601997 KEGG: hsa:637 STRING: 9606.ENSP00000318822 UniGene: PMID: 29969781 The caspase-8/Bid/cytochrome c axis links signals from death receptors to mitochondrial reactive oxygen species production. PMID: 28888620 administration of SMAC or BH3 mimetics following short-term paclitaxel treatment could be an effective therapeutic strategy for TNBC, while only BH3-mimetics could effectively overcome long-term paclitaxel resistance PMID: 28187446 caspase-10 was dispensable for enhancement of cisplatin/LA-12 and TRAIL combination-induced cell death and stimulation of Bid cleavage PMID: 29182622 an oligomeric arrangement of Bid, Bax, and possibly other members of the Bcl-2 family of proteins that form a self-propagating network that permeabilizes the outer-mitochondrial membrane. PMID: 27763642 Combined therapy with Seliciclib((R)) and Belinostat((R)) results in eradication of non-small cell lung cancer via apoptosis induction and BID activation. PMID: 27461583 Results from genome-wide DNA methylation, functional network analysis and pyrosequencing, show selective CpG sites (NOS1AP, BID, and GABRB1) differentially methylated in smokers and chronic obstructive pulmonary disease patients compared to nonsmokers. PMID: 28416970 The adenovirus-mediated truncated Bid overexpression induced by the Cre/LoxP system can effectively eliminate CD133+ ovarian cancer stem cells, representing a novel therapeutic strategy for the treatment of ovarian cancer. PMID: 27878291 MiR-20a-directed regulation of BID in colorectal cancer. PMID: 28004114 the results establish that cleavage by caspase 8 and the subsequent association with the outer mitochondrial membrane are two critical events that activate Bid during death receptor-mediated apoptosis. PMID: 27053107 The results indicate that BID-independent pathways are responsible for FAS-dependent human islet cell death in Type 1 diabetes. PMID: 26758067 The BID-MTCH2 axis regulates the differentiation/apoptosis of stem cells and mitochondrial metabolism. (Review) PMID: 26827940 Data suggest, in models of spatial propagation of mitochondrial permeabilization during apoptosis, there appears to be requirement for cooperative signaling involving truncated-BID and ROS (reactive oxygen species) for efficient/ robust propagation. PMID: 26699404 this study emphasizes that the coordinated action of hGzmB-activated p53 and GzmB-cleaved Bid is important for GzmB-induced cell death and for cytotoxic lymphocyte/Natural Killer Cell-mediated killing of target cells. PMID: 25404359 Tax confers apoptosis resistance to HTLV-1-infected T cells by suppressing the expression of Bim and Bid. PMID: 25522269 EG also activated the death receptor-dependent pathway of apoptosis by enhancing the expression of caspases-8, -9, and -3 and the Bcl-2 interacting domain (Bid). PMID: 23109891 Inhibition of NANOGP8 or NANOG enhances the cytotoxicity of BH3 mimetics. PMID: 25208882 JNK1/2 regulate Bid by direct phosphorylation at Thr59. PMID: 25077544 Association of BID gene polymorphisms with proteinuria of immunoglobulin A nephropathy PMID: 24621205 The extrinsic apoptotic pathway and BID are activated in adenomas from NSAID-treated patients. NSAIDS only activate BID in cells with APC deficiency and ensuing c-Myc activation. PMID: 25368155 Gli1 has a role in regulating the S-phase checkpoint in tumor cells via Bid protein, and its inhibition sensitizes to DNA topoisomerase 1 inhibitors PMID: 25253693 Bid is phosphorylated during mitosis within its regulatory loop and sensitizes mitochondria for mitochondrial outer membrane permeabilization if mitotic exit is delayed. PMID: 24767991 BID expression was found in 53.6% of gastric cancer patients. PMID: 24741635 BID is associated with ossification of the posterior longitudinal ligament , and both the G allele of a missense SNP (rs8190315, Ser10Gly) and C allele of a synonymous SNP (rs2072392, Asp60Asp) are risk factors for the development of ossification PMID: 24398548 Reduced Bid expression is associated with endometrial cancer. PMID: 24645842 FTY720 induces apoptosis of chronic myelogenous leukemia cells via dual activation of BIM and BID and overcomes various types of resistance to tyrosine kinase inhibitors. PMID: 23851982 structural details on the membrane-associated state of tBid and the functional implications of its membrane-associated BH3 domain PMID: 24158446 GrH induced cell death via a Bcl-2-sensitive mitochondrial pathway without direct processing of Bid. PMID: 23352961 Caspase-8 binding to cardiolipin in giant unilamellar vesicles provides a functional docking platform for bid PMID: 23418437 Three cathepsin D-specific cleavage sites in Bid, Phe24, Trp48, and Phe183, were identified. PMID: 22964611 Patients with Parkinson disease have an activated Bid-mediated destructive signal pathway via tumor necrosis factor death receptor I (TNFRI) in the temporal cortex. PMID: 23019260 Molecular basis of the interaction between proapoptotic truncated BID (tBID) protein and mitochondrial carrier homologue 2 (MTCH2) protein PMID: 22416135 Results suggest that truncated BID specifically interacts with phosphatidylserine/cardiolipin and decreases membrane integrity without the aid of other pro-apoptotic proteins. PMID: 22189507 14-3-3 theta/tau and tBID have roles as predictive biomarkers of neoadjuvant chemotherapy resistance in breast cancer PMID: 22115752 Decreased apoptosis and expression of Bid, increased level of Bcl-Xl may play some important roles in human jejunal stromal tumors, and Bcl-Xl/Bid ratio may be as a new potentially associated index. PMID: 22339673 Bid engages a ROS-dependent, local intermitochondrial potentiation mechanism that amplifies the apoptotic signal as a wave PMID: 22393005 critical for controlling cell viability regulated by IFN-alpha in ovarian adenocarcinoma cells PMID: 22130162 chronic ethanol increases CYP2E1 activity in adipose, leading to Bid-mediated apoptosis and activation of complement via C1q PMID: 21856753 show that due to the high affinity of BAX for BCL-2, BCL-w and A1, and of BAK for BCL-X(L), MCL-1 and A1, only a subset of BH3-only proteins, including BID, could be expected to free BAX or BAK from the antiapoptotic BCL-2 proteins to elicit apoptosis PMID: 21060336 a direct role for the BH3 interacting domain death agonist acting at the level of the DNA damage sensor complex to amplify the Atr-directed cellular response to replicative damage PMID: 21113148 Data show that the expression of apoptosis proteins caspase-3,-8,-9, and Bid in the RNP of the disc and the SNP was different in each patient. PMID: 21178828 Cells stabilize active caspase-8 on the mitochondria in order to specifically target mitochondria-associated BID. PMID: 21072056 When tBid was introduced into the HIV-1 LTR-based, Tat- and Rev-dependent transgene expression vector pLRed(INS)2R, very efficient induction of apoptosis was observed within 24 hours,but only in the presence of both HIV-1 regulatory proteins Tat and Rev. PMID: 21223573 tBID and other BCL-2 proteins have a role in osteosarcoma [commentary] PMID: 19029793 In rheumatoid arthritis fibroblast like synovial cells phosphorylation of Akt protects against Fas-induced apoptosis through inhibition of Bid cleavage. PMID: 20187936 The interface between apoptosis initiation and execution by determining caspase-8 activation, Bid cleavage and mitochondrial engagement (onset of mitochondrial depolarisation) in individual HeLa, was analysed. PMID: 20356928 Data revealed that the level of tBid expression in breast cancer cells were nearly 11 times more than normal cells because of the cancer specific promoters. PMID: 19918914 Bid may serve as a critical integrating factor of the death receptor and mitochondrial pathway in alpha-tocopheryl succinate-mediated apoptosis. PMID: 19640637 tBid-induced permeabilization of the outer membrane permits release of cytochrome c and Smac/DIABLO from all domains of intermembrane space. tBid-induced loss of DeltaPsi(m) occurs after cytochrome c release and reflects impairment of oxidative metabolism PMID: 11741882 Cytochrome c release upon Fas receptor activation on translocation of full-length bid PMID: 11790791

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.