Recombinant Human Chymotrypsin-Like Elastase Family Member 3B (CELA3B) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10992P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Chymotrypsin-Like Elastase Family Member 3B (CELA3B) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10992P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Chymotrypsin-Like Elastase Family Member 3B (CELA3B) Protein (His) is produced by our Baculovirus expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P08861 |
Target Symbol | CELA3B |
Synonyms | CELA3B; ELA3B; Chymotrypsin-like elastase family member 3B; EC 3.4.21.70; Elastase IIIB; Elastase-3B; Protease E |
Species | Homo sapiens (Human) |
Expression System | Baculovirus |
Tag | N-10His |
Target Protein Sequence | VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH |
Expression Range | 29-270aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 28.8 |
Research Area | Cell Biology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Efficient protease with alanine specificity but only little elastolytic activity. |
Protein Families | Peptidase S1 family, Elastase subfamily |
Database References | |
Tissue Specificity | Pancreas. Not detectable in keratinocytes. |
Gene Functions References
- The aim of this study was to examine the frequency of exocrine dysfunctions of the pancreas according to the level of fecal elastase-1 (FE-1) in patients with diabetes mellitus, type 1 and diabetes mellitus, type 2. PMID: 30106003
- this study demonstrated a strong association of diabetes with low pancreatic elastase levels in feces PMID: 27069032
- The results of the study suggest that the levels of apelin, TNF-alpha and elastase-1 are important diagnostic markers of CP in patients with type 2 diabetes mellitus. PMID: 26817104
- Recombinant type I pancreatic elastase improves unassisted arteriovenous fistula maturation in hemodialysis patients. PMID: 24684771
- A low value of faecal elastase-1, indicating reduced exocrine pancrease secretion, is strongly correlated with a poor survival in advanced pancreatic cancer. PMID: 22749648
- FE-1 is a poor surrogate for diagnosing impaired fat absorption. PMID: 22094930
- Hypermethylation of ELA3B gene promoter were associated with pancreatic cancer. PMID: 20428826
- As an independent variable, correlated with C-peptide and HBA1c levels in type 1 diabetes. PMID: 15277440
- pancreatic elastase induced proinflammatory effects are mediated by TLR4 and NF-kappaB in human myeloid cells PMID: 15351720
- Patients with type 1 diabetes and low fecal elastase 1 concentrations were succesfully treatted with pancretin. PMID: 17103488
- Fecal fat excretion is increased in patients with type 2 diabetes with fecal elastase deficiency. PMID: 17989309
- Neither low fecal elastase 1 nor raised fecal fat levels reliably indicate exocrine pancreatic insufficiency in type-1 diabetes. PMID: 18362841
- Reduced fecal elastase 1 connected with lowered serum levels of vitamin D3 is associated with osteoporotic bone fractures. PMID: 18424365
- Parathormone levels and Vitamin D metabolism in female patients with various grades of fecal ELA1 deficiency are reported. PMID: 19073396